(data stored in ACNUC7421 zone)

EMBL: CP002047.PE604

CP002047.PE604       Location/Qualifiers
FT   CDS             complement(768310..769842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00604"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="COG0747 ABC-type dipeptide transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00604"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03725"
FT                   /db_xref="GOA:D7C271"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D7C271"
FT                   /protein_id="ADI03725.1"
FT                   /translation="MRDNKQLTRHTGVVAATLASLLLAACSAGSTADGGGTGKSGKTDD
FT                   ALKIGLNAEPANLDITKTAGAAIPQALLYNVYENLVKVDQSGKIQPQLAKSWSLSKDRK
FT                   TYTFQLVKDAKFSSGAPFTAEDAKFSIERVKSDWTIAQKAQMDVVDTVQAVSPTELKVT
FT                   LKEPSNDWLYRMTTRVGVMFSRTGVSKLATEPVGTGPYVVKKWNRGDSITLARRDGYWG
FT                   SEPHFASVTLKYFKDPTAMNNALLTGTINVIGTMQTPDSLDRFANNSTYKVIEGTTNGE
FT                   VLLSLNNGSGPLKNLKARQAVRYAIDHKALLDTCWAGRGKLIGSMVPPTDPWYQDLTNQ
FT                   YPYDRDKAKKLLKESGVAGSTLRLRIPTLPYATACGTVVKSQLEQAGFKVTLDQLEFPA
FT                   AWLSTVFKNADYDMSIIGHLEPRDMQTVFGDKSYYTHYDNPEFRALLKKADKGTQEEQI
FT                   TAMRQAARLLSKDAAADWLFLLPNLMVADKDITGLPVDNVSESLDLTGLGRS"
     MRDNKQLTRH TGVVAATLAS LLLAACSAGS TADGGGTGKS GKTDDALKIG LNAEPANLDI        60
     TKTAGAAIPQ ALLYNVYENL VKVDQSGKIQ PQLAKSWSLS KDRKTYTFQL VKDAKFSSGA       120
     PFTAEDAKFS IERVKSDWTI AQKAQMDVVD TVQAVSPTEL KVTLKEPSND WLYRMTTRVG       180
     VMFSRTGVSK LATEPVGTGP YVVKKWNRGD SITLARRDGY WGSEPHFASV TLKYFKDPTA       240
     MNNALLTGTI NVIGTMQTPD SLDRFANNST YKVIEGTTNG EVLLSLNNGS GPLKNLKARQ       300
     AVRYAIDHKA LLDTCWAGRG KLIGSMVPPT DPWYQDLTNQ YPYDRDKAKK LLKESGVAGS       360
     TLRLRIPTLP YATACGTVVK SQLEQAGFKV TLDQLEFPAA WLSTVFKNAD YDMSIIGHLE       420
     PRDMQTVFGD KSYYTHYDNP EFRALLKKAD KGTQEEQITA MRQAARLLSK DAAADWLFLL       480
     PNLMVADKDI TGLPVDNVSE SLDLTGLGRS                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page