(data stored in ACNUC7421 zone)

EMBL: CP002047.PE606

CP002047.PE606       Location/Qualifiers
FT   CDS             771072..772538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00606"
FT                   /product="amidase"
FT                   /EC_number="3.5.1.4"
FT                   /note="COG0154 Asp-tRNAAsn/Glu-tRNAGln amidotransferase A
FT                   subunit and related amidases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00606"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03727"
FT                   /db_xref="GOA:D7C273"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D7C273"
FT                   /protein_id="ADI03727.1"
FT                   /translation="MLTEQGLATMPAVEMVAGFADHTLSPVQVHDAVQAVIEARESVLN
FT                   AFWVRDPDESRKAALASEARWAAGEPLGPIDGVPVTLKENVARRGVPMPSGNAGTVPVV
FT                   PEADAPITARVLESGGVVLGSTVMPDWGMLSSGVSSRHGITRSPWNPAWTTGGSSSGAG
FT                   AAAAGGYGPLHVGTDIGGSIRLPGTWLGLATLKPSYGRIPLDAPYLGRAAGPMARTVAD
FT                   AALFMSVLSRPDPRDWSSLPPQDINWSASAGEVRGLRVGVQLDAGCGEPCDAEVRAAVN
FT                   RAAALFEAAGAVVEPVEPFMSQDLLDDLDLFWRVRSWNDFRELPAEAKLRVHPSIIRWC
FT                   QGGADVPGTRVLQCYQQIMRIQERTVAATLPYDLVLSPVAPVAAFPAEQPMPFLEDAKT
FT                   MAHIGFTAPYNMSGQPAATVNCGLTADGRPIGVQLAGRRFDDLGVLRAAAWYEQNRPAE
FT                   AVPHWPDSAPGATTGATTGEKTTTLEGEKP"
     MLTEQGLATM PAVEMVAGFA DHTLSPVQVH DAVQAVIEAR ESVLNAFWVR DPDESRKAAL        60
     ASEARWAAGE PLGPIDGVPV TLKENVARRG VPMPSGNAGT VPVVPEADAP ITARVLESGG       120
     VVLGSTVMPD WGMLSSGVSS RHGITRSPWN PAWTTGGSSS GAGAAAAGGY GPLHVGTDIG       180
     GSIRLPGTWL GLATLKPSYG RIPLDAPYLG RAAGPMARTV ADAALFMSVL SRPDPRDWSS       240
     LPPQDINWSA SAGEVRGLRV GVQLDAGCGE PCDAEVRAAV NRAAALFEAA GAVVEPVEPF       300
     MSQDLLDDLD LFWRVRSWND FRELPAEAKL RVHPSIIRWC QGGADVPGTR VLQCYQQIMR       360
     IQERTVAATL PYDLVLSPVA PVAAFPAEQP MPFLEDAKTM AHIGFTAPYN MSGQPAATVN       420
     CGLTADGRPI GVQLAGRRFD DLGVLRAAAW YEQNRPAEAV PHWPDSAPGA TTGATTGEKT       480
     TTLEGEKP                                                                488
//

If you have problems or comments...

PBIL Back to PBIL home page