(data stored in ACNUC7421 zone)

EMBL: CP002047.PE608

CP002047.PE608       Location/Qualifiers
FT   CDS             complement(773318..776548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00608"
FT                   /product="putative methylmalonyl-CoA mutase"
FT                   /note="COG2185 Methylmalonyl-CoA mutase, C-terminal
FT                   domain/subunit (cobalamin-binding)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00608"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03729"
FT                   /db_xref="GOA:D7C275"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033669"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:D7C275"
FT                   /protein_id="ADI03729.1"
FT                   /translation="MNDLHRPVHPVRLVTASALFDGHDASINIMRRIFQSQGAEVIHLG
FT                   HNRSVREVVDAALEEDAHGVAVSSYQGGHVEYFEYLAASLRERGADHVRVVGGGGGVIV
FT                   PEEIARLRECGVTIFSPEDGQRLGLAGMVNSVVRDCDFDLWDRKPADAAAVLAGDRFAI
FT                   ARAITGAELGKLPPELLEQMRAAAAARVTPVLGITGTGGSGKSSLTDELVRRFRVDQHD
FT                   KLRIAVIAVDPTRRRGGGALLGDRIRMNSLDGHRVFFRSLATRGSRELPEQLSDVIDVV
FT                   KAAGFDLVVVETPGIGQGDAAIVPFVDTSLYVMTPEFGAASQLEKIDMLDFADVVAINK
FT                   FERRGAKDALRDVGRQLVRNREAFGMRPEDMPVYGTSAATFNDDGVTALYQYLRTALAE
FT                   RGLPLSEGTLPPVDVRHSSGIRQVVPTDRVRYLAEINETVRRYHEETERLAGAARRVQR
FT                   LDAVRGELVEAGSDAGSVQSLLEDARKQLPHDVTEQIGNWPTVVAAYSGDEQVVKVRDR
FT                   EIRTKLTRESLSGNKVPRVALPRFTDHGELVRFWRRENLPGYFPFTAGVFPFKRDGEDP
FT                   ARMFAGEGDPFRTNRRFKLLSEGQPATRLSTAFDSVTLYGRDPGERPDIYGKVGTSGVS
FT                   VATLEDMKALYDGFDLVAPTTSVSMTINGPAPTILAFFLNTAIDQQTERFRTAEGRDPS
FT                   PEEAARLRAHALASVRGTVQADILKEDQGQNTCLFSTEFSLRMMADIQEWFIAHKVRNF
FT                   YSVSISGYHIAEAGANPISQLAFTLANGFTYVEAYLARGMDIDDFAPNLSFFFSNGMDP
FT                   EYSVLGRVARRIWAVAMKEKYGANERSQKLKYHVQTSGRSLHAQEMDFNDIRTTLQALI
FT                   AIYDNCNSLHTNAYDEAVTTPTEDSVRRALAIQLIINREWGLAMNENPLQGSFIIDELT
FT                   DLVEAAVLAEFERISERGGVLGAMETGYQRGRIQDESMLYEQRKHDGTLPIIGVNTFRN
FT                   PRADTAEPGTIELARATEQEKESQLERVGDYQARHRDQAHAALMALKDAAVNGHNVFAV
FT                   LMDAARVCSLQQITEAFFEVGGQYRRNV"
     MNDLHRPVHP VRLVTASALF DGHDASINIM RRIFQSQGAE VIHLGHNRSV REVVDAALEE        60
     DAHGVAVSSY QGGHVEYFEY LAASLRERGA DHVRVVGGGG GVIVPEEIAR LRECGVTIFS       120
     PEDGQRLGLA GMVNSVVRDC DFDLWDRKPA DAAAVLAGDR FAIARAITGA ELGKLPPELL       180
     EQMRAAAAAR VTPVLGITGT GGSGKSSLTD ELVRRFRVDQ HDKLRIAVIA VDPTRRRGGG       240
     ALLGDRIRMN SLDGHRVFFR SLATRGSREL PEQLSDVIDV VKAAGFDLVV VETPGIGQGD       300
     AAIVPFVDTS LYVMTPEFGA ASQLEKIDML DFADVVAINK FERRGAKDAL RDVGRQLVRN       360
     REAFGMRPED MPVYGTSAAT FNDDGVTALY QYLRTALAER GLPLSEGTLP PVDVRHSSGI       420
     RQVVPTDRVR YLAEINETVR RYHEETERLA GAARRVQRLD AVRGELVEAG SDAGSVQSLL       480
     EDARKQLPHD VTEQIGNWPT VVAAYSGDEQ VVKVRDREIR TKLTRESLSG NKVPRVALPR       540
     FTDHGELVRF WRRENLPGYF PFTAGVFPFK RDGEDPARMF AGEGDPFRTN RRFKLLSEGQ       600
     PATRLSTAFD SVTLYGRDPG ERPDIYGKVG TSGVSVATLE DMKALYDGFD LVAPTTSVSM       660
     TINGPAPTIL AFFLNTAIDQ QTERFRTAEG RDPSPEEAAR LRAHALASVR GTVQADILKE       720
     DQGQNTCLFS TEFSLRMMAD IQEWFIAHKV RNFYSVSISG YHIAEAGANP ISQLAFTLAN       780
     GFTYVEAYLA RGMDIDDFAP NLSFFFSNGM DPEYSVLGRV ARRIWAVAMK EKYGANERSQ       840
     KLKYHVQTSG RSLHAQEMDF NDIRTTLQAL IAIYDNCNSL HTNAYDEAVT TPTEDSVRRA       900
     LAIQLIINRE WGLAMNENPL QGSFIIDELT DLVEAAVLAE FERISERGGV LGAMETGYQR       960
     GRIQDESMLY EQRKHDGTLP IIGVNTFRNP RADTAEPGTI ELARATEQEK ESQLERVGDY      1020
     QARHRDQAHA ALMALKDAAV NGHNVFAVLM DAARVCSLQQ ITEAFFEVGG QYRRNV          1076
//

If you have problems or comments...

PBIL Back to PBIL home page