(data stored in ACNUC7421 zone)

EMBL: CP002047.PE609

CP002047.PE609       Location/Qualifiers
FT   CDS             complement(776665..777429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00609"
FT                   /product="hypothetical protein"
FT                   /note="COG0614 ABC-type Fe3+-hydroxamate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00609"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03730"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D7C276"
FT                   /protein_id="ADI03730.1"
FT                   /translation="MPPLYDDMGTAVHLARPPRRVVSLVPSLTEAVADGHPEVLVGATQ
FT                   WCTHPGDLDVVRVRGTKNPDREAIARLRPDLVIANKEENRELDVTRLRAAGVPVWVTVI
FT                   ETVPQALDSLERLFAEALQVPVPDWLDAARELWSGPLPEATVTAAVPIWRDPWMVVGRS
FT                   TFTGDLLRRAGVANAFARHPDRYPHMALEEIDQPDVGVVLLPDEPYVFTESDGPEAFRR
FT                   TPTRLVSGRLITWYGPSLLPAHEMLRRLVAAL"
     MPPLYDDMGT AVHLARPPRR VVSLVPSLTE AVADGHPEVL VGATQWCTHP GDLDVVRVRG        60
     TKNPDREAIA RLRPDLVIAN KEENRELDVT RLRAAGVPVW VTVIETVPQA LDSLERLFAE       120
     ALQVPVPDWL DAARELWSGP LPEATVTAAV PIWRDPWMVV GRSTFTGDLL RRAGVANAFA       180
     RHPDRYPHMA LEEIDQPDVG VVLLPDEPYV FTESDGPEAF RRTPTRLVSG RLITWYGPSL       240
     LPAHEMLRRL VAAL                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page