(data stored in ACNUC7421 zone)

EMBL: CP002047.PE611

CP002047.PE611       Location/Qualifiers
FT   CDS             778197..778421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00611"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03732"
FT                   /db_xref="UniProtKB/TrEMBL:D7C278"
FT                   /protein_id="ADI03732.1"
FT                   /translation="MIAAVVEESGAHGFLERLDQRGGRPAAERGGVVETETASQHRSHL
FT                   EEAQRAGLQGPGIRANPPLPVRATEAISA"
     MIAAVVEESG AHGFLERLDQ RGGRPAAERG GVVETETASQ HRSHLEEAQR AGLQGPGIRA        60
     NPPLPVRATE AISA                                                          74
//

If you have problems or comments...

PBIL Back to PBIL home page