(data stored in ACNUC7421 zone)

EMBL: CP002047.PE612

CP002047.PE612       Location/Qualifiers
FT   CDS             778910..780310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00612"
FT                   /product="integral membrane protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00612"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03733"
FT                   /db_xref="GOA:D7C279"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7C279"
FT                   /protein_id="ADI03733.1"
FT                   /translation="MSEAVVSPVRIGRLSIGALGALALALGTLQTVVDPALPLLQRELG
FT                   VSSGEGALVSNAVLITGAAVAPVAGKLGDRYGGKRVLVRLMAVVSAGGLLAGLAPNLPV
FT                   LLLGQVLQGAMVGALPLSFILVRKHLPAGESQLGMGLVMALFTGGGMVGTLTAGPIAEG
FT                   LSWHWMFALPTIAIIATTLVVARLMPHDPPIESEYGIDWPGVVLLSGTLLAFMLGLVRV
FT                   TGDDGLPPLTVGALAVVVAALATGWVVVERRAASPMVDLRMLAKPAMWHACMLTIVITT
FT                   SFGMVSFLLPQLFGVPGDGYGFGASTTDIGLFLLPGAIAGAVSDSVGGITARRFGLRAV
FT                   VVVGAVVTAATMTTLVSLHTAEWQLVLAKALAAMAAGVGTTALLTSAATAVETRDIGIA
FT                   TSVLVVTRVIGIALGVQIAAAILDAGADPTTGLPTESAFVTGFAVAGLVAALSLLVVRI
FT                   TKKKGAQA"
     MSEAVVSPVR IGRLSIGALG ALALALGTLQ TVVDPALPLL QRELGVSSGE GALVSNAVLI        60
     TGAAVAPVAG KLGDRYGGKR VLVRLMAVVS AGGLLAGLAP NLPVLLLGQV LQGAMVGALP       120
     LSFILVRKHL PAGESQLGMG LVMALFTGGG MVGTLTAGPI AEGLSWHWMF ALPTIAIIAT       180
     TLVVARLMPH DPPIESEYGI DWPGVVLLSG TLLAFMLGLV RVTGDDGLPP LTVGALAVVV       240
     AALATGWVVV ERRAASPMVD LRMLAKPAMW HACMLTIVIT TSFGMVSFLL PQLFGVPGDG       300
     YGFGASTTDI GLFLLPGAIA GAVSDSVGGI TARRFGLRAV VVVGAVVTAA TMTTLVSLHT       360
     AEWQLVLAKA LAAMAAGVGT TALLTSAATA VETRDIGIAT SVLVVTRVIG IALGVQIAAA       420
     ILDAGADPTT GLPTESAFVT GFAVAGLVAA LSLLVVRITK KKGAQA                      466
//

If you have problems or comments...

PBIL Back to PBIL home page