(data stored in ACNUC7421 zone)

EMBL: CP002047.PE614

CP002047.PE614       Location/Qualifiers
FT   CDS             complement(781777..782457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00614"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family protein"
FT                   /note="COG2197 Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00614"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03735"
FT                   /db_xref="GOA:D7C281"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D7C281"
FT                   /protein_id="ADI03735.1"
FT                   /translation="MLLADDQALLRGAFRMLLDSADDITVVGEAADGREAVRLTRELRP
FT                   DVVIMDIRMPEVDGLTATSEICADPELRASRILILTTYETDEYVAQALRAGAGGFIGKG
FT                   IGAEDLLDAVRTIADGDTLLSPAATRSLVARFLATPDDTPSHHPEQLAVLTPREREMVA
FT                   LVATGLSNQEIAERMFLSPFTVRAHVQRAMTKLEARDRAQLVVIAYRTGLAHAAPDGGT
FT                   GRLP"
     MLLADDQALL RGAFRMLLDS ADDITVVGEA ADGREAVRLT RELRPDVVIM DIRMPEVDGL        60
     TATSEICADP ELRASRILIL TTYETDEYVA QALRAGAGGF IGKGIGAEDL LDAVRTIADG       120
     DTLLSPAATR SLVARFLATP DDTPSHHPEQ LAVLTPRERE MVALVATGLS NQEIAERMFL       180
     SPFTVRAHVQ RAMTKLEARD RAQLVVIAYR TGLAHAAPDG GTGRLP                      226
//

If you have problems or comments...

PBIL Back to PBIL home page