(data stored in ACNUC7421 zone)

EMBL: CP002047.PE615

CP002047.PE615       Location/Qualifiers
FT   CDS             complement(782466..783887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00615"
FT                   /product="histidine kinase"
FT                   /note="COG4585 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00615"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03736"
FT                   /db_xref="GOA:D7C282"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7C282"
FT                   /protein_id="ADI03736.1"
FT                   /translation="MSRPPQPSWTQRCRGSPSAGTGTEPAMTNTGGGGPRPRGTWWREA
FT                   AVTATAFALCLLGGVVQNDGSTLSPPPPAAYFIAVVSCAVLPVRHRAPLAAMAATTASG
FT                   MLVPPLGLLLSPLIVAPAVITAYSLTVRTERHAVSAVSLTSVALLVASTPLFGALSWKD
FT                   ASRVGAVAAFPLVAGVLGHSVQNRRAYLAAVEERAQRAEQSRDSEARRRVAEERVRIAR
FT                   ELHDLVAHQITLANAQATVAAHLFDARPEQTRKSLKELVETTGHALDELRATVGLLRQS
FT                   GDAAGPAEPAPGLSRLPTLLESFRRAGLEVSVHQEGTARPLPPGVDLTAYRIVQEALTN
FT                   VTKHAGTGSARVRLVWNRDRVTITVADDGGGARTAPTASTGPSASTVPDRPPGYGLIGM
FT                   RERATAVGGHLSAGRRPEGGFLVSTQLPLPPAKDTTRRTDGATTIEGPMADGVTGDGQR
FT                   TGDGRTDGGETGDAP"
     MSRPPQPSWT QRCRGSPSAG TGTEPAMTNT GGGGPRPRGT WWREAAVTAT AFALCLLGGV        60
     VQNDGSTLSP PPPAAYFIAV VSCAVLPVRH RAPLAAMAAT TASGMLVPPL GLLLSPLIVA       120
     PAVITAYSLT VRTERHAVSA VSLTSVALLV ASTPLFGALS WKDASRVGAV AAFPLVAGVL       180
     GHSVQNRRAY LAAVEERAQR AEQSRDSEAR RRVAEERVRI ARELHDLVAH QITLANAQAT       240
     VAAHLFDARP EQTRKSLKEL VETTGHALDE LRATVGLLRQ SGDAAGPAEP APGLSRLPTL       300
     LESFRRAGLE VSVHQEGTAR PLPPGVDLTA YRIVQEALTN VTKHAGTGSA RVRLVWNRDR       360
     VTITVADDGG GARTAPTAST GPSASTVPDR PPGYGLIGMR ERATAVGGHL SAGRRPEGGF       420
     LVSTQLPLPP AKDTTRRTDG ATTIEGPMAD GVTGDGQRTG DGRTDGGETG DAP              473
//

If you have problems or comments...

PBIL Back to PBIL home page