(data stored in ACNUC7421 zone)

EMBL: CP002047.PE616

CP002047.PE616       Location/Qualifiers
FT   CDS             complement(783817..786099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00616"
FT                   /product="membrane transport protein"
FT                   /note="COG2409 Predicted drug exporters of the RND
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00616"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03737"
FT                   /db_xref="GOA:D7C283"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:D7C283"
FT                   /protein_id="ADI03737.1"
FT                   /translation="MATFLYRIGRWAFRRRRLVGGLWLGVLVLAVVAAAMAPEGKEEDL
FT                   SMPGTESQKAFDLLDERFPQSNSQGAEARLVFRAPDGQRVTARENKAAVENTLGSLDGG
FT                   DQVASTTDPYETGAVSEDGTIAYSTITYTADAVDLAEPTKSALEDAASQARDAGLTVEI
FT                   GGSALDSEEEPGGTTEIIGVAVAAVVLVLALGSLVAAGLSLLTAFVGVAIAFGLVSALA
FT                   VPLGLTSTVAILALMLGLAVGIDYALFITSRFRDERAQGSEPEEAAGRAVGTAGSAVVF
FT                   AGATVFIALVGLGVVGIPELTKMGMGGAGAVALAVLVALTLVPALFGFFGRRVLSRAVR
FT                   KEPSYRRSGSERPGSERPHPVPTAAGRPGLGTRWARFVLRRPAAVLLIAGLGLGAVALP
FT                   ALSLELGLPGDESKSVETTQRRAYDLLSEGFGPGFNGPLTLVVDMPASSGSGDTRATTD
FT                   LVAKTVRGVDGVASVGDPVLSRGKDTAVLTAVPQTAPNSGETKDLVHAIRGAVSGVEAD
FT                   TGADILVTGTTAMNIDISEAMSDALVPYLTVVIGLAVLLLMVVFRSVLVPVKAALGFLL
FT                   SVGAAFGVLVAVFQWGWAADLIGIEQTGPVMSLMPILIIGIVFGLAMDYEVFLLTRMRE
FT                   AYVHGASPGEAIVNGFRHSGRVVAAAAIIMISVFAGFIGMSSPTIQTMGVGLAAAVAFD
FT                   AFVVRMAIAPAVLALLGHRAWWLPRILNRVLPNVDIEGEKLSRHVPASAAELDAAVPRL
FT                   PVGRHRH"
     MATFLYRIGR WAFRRRRLVG GLWLGVLVLA VVAAAMAPEG KEEDLSMPGT ESQKAFDLLD        60
     ERFPQSNSQG AEARLVFRAP DGQRVTAREN KAAVENTLGS LDGGDQVAST TDPYETGAVS       120
     EDGTIAYSTI TYTADAVDLA EPTKSALEDA ASQARDAGLT VEIGGSALDS EEEPGGTTEI       180
     IGVAVAAVVL VLALGSLVAA GLSLLTAFVG VAIAFGLVSA LAVPLGLTST VAILALMLGL       240
     AVGIDYALFI TSRFRDERAQ GSEPEEAAGR AVGTAGSAVV FAGATVFIAL VGLGVVGIPE       300
     LTKMGMGGAG AVALAVLVAL TLVPALFGFF GRRVLSRAVR KEPSYRRSGS ERPGSERPHP       360
     VPTAAGRPGL GTRWARFVLR RPAAVLLIAG LGLGAVALPA LSLELGLPGD ESKSVETTQR       420
     RAYDLLSEGF GPGFNGPLTL VVDMPASSGS GDTRATTDLV AKTVRGVDGV ASVGDPVLSR       480
     GKDTAVLTAV PQTAPNSGET KDLVHAIRGA VSGVEADTGA DILVTGTTAM NIDISEAMSD       540
     ALVPYLTVVI GLAVLLLMVV FRSVLVPVKA ALGFLLSVGA AFGVLVAVFQ WGWAADLIGI       600
     EQTGPVMSLM PILIIGIVFG LAMDYEVFLL TRMREAYVHG ASPGEAIVNG FRHSGRVVAA       660
     AAIIMISVFA GFIGMSSPTI QTMGVGLAAA VAFDAFVVRM AIAPAVLALL GHRAWWLPRI       720
     LNRVLPNVDI EGEKLSRHVP ASAAELDAAV PRLPVGRHRH                             760
//

If you have problems or comments...

PBIL Back to PBIL home page