(data stored in ACNUC7421 zone)

EMBL: CP002047.PE618

CP002047.PE618       Location/Qualifiers
FT   CDS             complement(786606..792845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00618"
FT                   /product="putative non-ribosomal peptide synthetase"
FT                   /note="COG1020 Non-ribosomal peptide synthetase modules and
FT                   related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00618"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03739"
FT                   /db_xref="GOA:D7C285"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7C285"
FT                   /protein_id="ADI03739.1"
FT                   /translation="MSPAQRGPWSLYQLHGPDGTHNVPVVTRIPGVVDREALTAALTDL
FT                   TVRHEALRTLYAEREGVPVQIVVPADRARPRPRFTDTTAEQAEDAIARACAHAIDLSTD
FT                   LPLHAELITTGPKDSNSTLVLTIHHIAIDAWSVRPLLRDFDTAYTARTGGGAPQWGSPP
FT                   RYADHVTETANRLQQLGDRQRKYWTDQLADLPEELRLPVDRPRGQAPGPRPDTVDFTVG
FT                   AEPARAVRASALSRGISMSTVAQAAVAALLHRVGAGDDIPLGIPVSGRPHGESRDLVGR
FT                   FANSLVLRIGLSGDTGFDELLTQVHATLLTAHEHRDLPFEELVEATGKAVSRDPAHHPL
FT                   CQVMVGSLAAAAAPEAPPIDQRADAYDLRFDLAEQGPDGRLHGRIAYRPDLFDPHTAES
FT                   LAQRLVRLLEQVAADPEQPVGRLDVLVADERALVVDGWNDTAHEVPSKTLPELFRAQVA
FT                   RTPDATALVFRDERLTYADLDARVERLARVLAGKGAGPGETVAVALPRSVELVATLLAV
FT                   HRTGAAYLPLDTQYPAERTAFMLDDARPVLVLDGAAPDGPPGELPKAYAPNLPAYVIYT
FT                   SGSTGRPKGVVVPHAGIVNRLLWMRDEYGLSAADRVLQKTSASFDVSVWELFLPLITGA
FT                   TLVVAEPDGHRDPAYLSELIESERITTVHFVPSMLEVFLDALAAEPSAAGCATVRRVIC
FT                   SGEALPAPLAGRFHRVLPTAELHNLYGPTEASVDVTAAQVIPGVEPVPIGRPVWNTRVY
FT                   VLDTALQPVPPGAVGELYLAGVQLAHGYLSRPGLTAGRFVADPYGDVPGARMYRTGDLG
FT                   RRTRDGLLEFLGRADDQVKVHGFRIEPGEIEAVLHAHESVARAVVVAHEQRLLAYVVPA
FT                   PGRVPGETELRDLAQSALPEYMVPSAVIALDALPLTPNGKLDRKALRTSPAHTPGPDGS
FT                   AALGEPERTLGALFAEVLGMTRVGPDDSFFDLGGHSLLAIRLINRIRVRFGVRLKVRTL
FT                   FEAPTVAQLAPRLAEESADRTPPGVVAVVPRPEVLPLSPVQRGLWFLHQLHGPDATHNV
FT                   PVVTRIQGAVDRDALTAALADLTVRHEALRTLYAEREGVTVQIVVPADRARPRPRFTDT
FT                   TAEQAEDAIARACAHAIDLSTDLPLHAELITTGPQDSTLVLTIHHIAIDAWSMRPLTTD
FT                   LARAYAARTRGEAPDWEPLPVQYADYALWYEDTIGDAGDPAGVQSHQLDYWRTALAGLP
FT                   EELTLPADRPRPARASRRGGQVELPIDQALDQRLRQLARTHGVTPYMVAQAALAALFTQ
FT                   LGAGTDIPLGAVVAARPDHTLHDLVGYFLNTLVLRTDTSGDPSFSDLLARVRVTDLAAF
FT                   EHQQLPFDRLVEELQPTRSPSRNPLFQTALVWTDATSAALELPGLRCEPGPVPLDVVKF
FT                   DLEFEFSEHRGSGGSGGSGGSGGSGGSGLRLSVGYATDLYAPATALSLGRRLIQLLEQA
FT                   TAAPDARLSTFQVLLPDERKRILEEWGRGAEVESATIPDLFEEQVRQRPDAIAVEDGDG
FT                   GVTYAELSASVNRLARYLIERGVGPEVPVAVSAERGPGLLVAMLAVLTAGGAYLPIDPA
FT                   YPPARMAFMLADTAATMALVDDPARLGDADIETTVLGGLGLAGFPATEVSDDDRLAPLR
FT                   IASTAYVIYTSGSTGMPKGVAVPHTGITRLISTHTSALGVGPQSVVLQLASIGFDASVW
FT                   EIGMALLTGARLRFIRPEALAEAEHGSTPAHGATHVWISPTLLSALPSAAVPAGTTIVT
FT                   GSEAVPQMVADLWSVDNPLFNLYGPTEVTVGSTGAFLAPGRSVTIGGPIAGTQAYVLDD
FT                   ALRPVPPGVDGELYLAGPGVTRGYVGRAGLTATRFVACPFGAAGERMYRTGDMVRWTAD
FT                   GNLLYLGRTDDQVKLRGFRIEPGEIEATLTALPGVRQAVVTLREDRPGDKRLVAYVISD
FT                   TGAALDTAVLADRLAERLPTYMVPSAFVQLAALPLTINAKLDRAALPAPGHTAASTSQL
FT                   PRNDREEALCKLFADILGVPDVSRDDSFFELGGHSLLAMLLVNRVRAQFGIGLDLQTVF
FT                   EAPTVAELTPHLDNGRRARPALRPRNRP"
     MSPAQRGPWS LYQLHGPDGT HNVPVVTRIP GVVDREALTA ALTDLTVRHE ALRTLYAERE        60
     GVPVQIVVPA DRARPRPRFT DTTAEQAEDA IARACAHAID LSTDLPLHAE LITTGPKDSN       120
     STLVLTIHHI AIDAWSVRPL LRDFDTAYTA RTGGGAPQWG SPPRYADHVT ETANRLQQLG       180
     DRQRKYWTDQ LADLPEELRL PVDRPRGQAP GPRPDTVDFT VGAEPARAVR ASALSRGISM       240
     STVAQAAVAA LLHRVGAGDD IPLGIPVSGR PHGESRDLVG RFANSLVLRI GLSGDTGFDE       300
     LLTQVHATLL TAHEHRDLPF EELVEATGKA VSRDPAHHPL CQVMVGSLAA AAAPEAPPID       360
     QRADAYDLRF DLAEQGPDGR LHGRIAYRPD LFDPHTAESL AQRLVRLLEQ VAADPEQPVG       420
     RLDVLVADER ALVVDGWNDT AHEVPSKTLP ELFRAQVART PDATALVFRD ERLTYADLDA       480
     RVERLARVLA GKGAGPGETV AVALPRSVEL VATLLAVHRT GAAYLPLDTQ YPAERTAFML       540
     DDARPVLVLD GAAPDGPPGE LPKAYAPNLP AYVIYTSGST GRPKGVVVPH AGIVNRLLWM       600
     RDEYGLSAAD RVLQKTSASF DVSVWELFLP LITGATLVVA EPDGHRDPAY LSELIESERI       660
     TTVHFVPSML EVFLDALAAE PSAAGCATVR RVICSGEALP APLAGRFHRV LPTAELHNLY       720
     GPTEASVDVT AAQVIPGVEP VPIGRPVWNT RVYVLDTALQ PVPPGAVGEL YLAGVQLAHG       780
     YLSRPGLTAG RFVADPYGDV PGARMYRTGD LGRRTRDGLL EFLGRADDQV KVHGFRIEPG       840
     EIEAVLHAHE SVARAVVVAH EQRLLAYVVP APGRVPGETE LRDLAQSALP EYMVPSAVIA       900
     LDALPLTPNG KLDRKALRTS PAHTPGPDGS AALGEPERTL GALFAEVLGM TRVGPDDSFF       960
     DLGGHSLLAI RLINRIRVRF GVRLKVRTLF EAPTVAQLAP RLAEESADRT PPGVVAVVPR      1020
     PEVLPLSPVQ RGLWFLHQLH GPDATHNVPV VTRIQGAVDR DALTAALADL TVRHEALRTL      1080
     YAEREGVTVQ IVVPADRARP RPRFTDTTAE QAEDAIARAC AHAIDLSTDL PLHAELITTG      1140
     PQDSTLVLTI HHIAIDAWSM RPLTTDLARA YAARTRGEAP DWEPLPVQYA DYALWYEDTI      1200
     GDAGDPAGVQ SHQLDYWRTA LAGLPEELTL PADRPRPARA SRRGGQVELP IDQALDQRLR      1260
     QLARTHGVTP YMVAQAALAA LFTQLGAGTD IPLGAVVAAR PDHTLHDLVG YFLNTLVLRT      1320
     DTSGDPSFSD LLARVRVTDL AAFEHQQLPF DRLVEELQPT RSPSRNPLFQ TALVWTDATS      1380
     AALELPGLRC EPGPVPLDVV KFDLEFEFSE HRGSGGSGGS GGSGGSGGSG LRLSVGYATD      1440
     LYAPATALSL GRRLIQLLEQ ATAAPDARLS TFQVLLPDER KRILEEWGRG AEVESATIPD      1500
     LFEEQVRQRP DAIAVEDGDG GVTYAELSAS VNRLARYLIE RGVGPEVPVA VSAERGPGLL      1560
     VAMLAVLTAG GAYLPIDPAY PPARMAFMLA DTAATMALVD DPARLGDADI ETTVLGGLGL      1620
     AGFPATEVSD DDRLAPLRIA STAYVIYTSG STGMPKGVAV PHTGITRLIS THTSALGVGP      1680
     QSVVLQLASI GFDASVWEIG MALLTGARLR FIRPEALAEA EHGSTPAHGA THVWISPTLL      1740
     SALPSAAVPA GTTIVTGSEA VPQMVADLWS VDNPLFNLYG PTEVTVGSTG AFLAPGRSVT      1800
     IGGPIAGTQA YVLDDALRPV PPGVDGELYL AGPGVTRGYV GRAGLTATRF VACPFGAAGE      1860
     RMYRTGDMVR WTADGNLLYL GRTDDQVKLR GFRIEPGEIE ATLTALPGVR QAVVTLREDR      1920
     PGDKRLVAYV ISDTGAALDT AVLADRLAER LPTYMVPSAF VQLAALPLTI NAKLDRAALP      1980
     APGHTAASTS QLPRNDREEA LCKLFADILG VPDVSRDDSF FELGGHSLLA MLLVNRVRAQ      2040
     FGIGLDLQTV FEAPTVAELT PHLDNGRRAR PALRPRNRP                             2079
//

If you have problems or comments...

PBIL Back to PBIL home page