(data stored in ACNUC7421 zone)

EMBL: CP002047.PE622

CP002047.PE622       Location/Qualifiers
FT   CDS             complement(796294..796560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00622"
FT                   /product="MbtH domain protein"
FT                   /note="COG3251 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00622"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03743"
FT                   /db_xref="InterPro:IPR005153"
FT                   /db_xref="InterPro:IPR037407"
FT                   /db_xref="InterPro:IPR038020"
FT                   /db_xref="UniProtKB/TrEMBL:D7C289"
FT                   /protein_id="ADI03743.1"
FT                   /translation="MTAYTSDREEFAMTNPFDDENGHFRVLVNAEGQHSLWPTFAEVPD
FT                   GWEIRLGDSSRKDCLAYIEKHWTDMRPTSLVAAMAADSQGEAE"
     MTAYTSDREE FAMTNPFDDE NGHFRVLVNA EGQHSLWPTF AEVPDGWEIR LGDSSRKDCL        60
     AYIEKHWTDM RPTSLVAAMA ADSQGEAE                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page