(data stored in ACNUC7421 zone)

EMBL: CP002047.PE624

CP002047.PE624       Location/Qualifiers
FT   CDS             797881..801825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00624"
FT                   /product="nonribosomal peptide synthetase DhbF"
FT                   /note="COG1020 Non-ribosomal peptide synthetase modules and
FT                   related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00624"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03745"
FT                   /db_xref="GOA:D7C291"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7C291"
FT                   /protein_id="ADI03745.1"
FT                   /translation="MGVRVADLIPLSFAQQRLWLIDRLEGPSAVYNVPLALRFSGAVNH
FT                   GALEAALRDVVVRHESLRTVFTERADKEEMAHQDILGPEALSVPFEVGETHEGGLAEEL
FT                   EEFGARPFDLAREIPVRARLLLLAPEESVLALVIHHTACDGWSIGPLFRDLGTAYRARC
FT                   RPDGGAPQWAPLPVQYADYALWQREMLGDEDDPDSEVSRQSAFWSAELTGLPEQLPLPA
FT                   DRARPAVSGFRGEAVPIEVGAEAHRVLTRLARDARASSFMVVQVALALLLTRLGAGTDI
FT                   PIGTVTAGRDEVALEELVGFFANTLVLRTDTSGNPTFRELLERVRSRTLKAYAHGELPF
FT                   ERVVELVRPGRSLARHPLFQVMLVFQPEGDAVPDLPGLRVGLEEVDTPSAKFDLTLSLR
FT                   ERFGRDGEPLGLSGELRYRTDLFDHGTSERMAARLVRILAAAARNPELPVGSIDILDAA
FT                   ERHRVLTEWNDTDLAAPTPSLPALFSAQAARTPAAPAVSDKGLVLTYAELDARANRLAH
FT                   LLAARGIGPEKLVAVALPRSAQAVIALLAVLKAGGAYLPLDPGYPVERLGAMLRDARPE
FT                   LVLTTGQADPTAESAIPRLCLDSSPVQAELESRPATDPAVRTHPGHPVYVIYTSGSSGR
FT                   PKGVVVTHGALADYLAWARRAYPATAGTVLLHTSLSFDLTVTALWTPLTVGGCLFTASI
FT                   AEIAEIAEIAEMRGNDSGPAQSAGVVFTFVKATPSHLPLLAEASDICSPTGQLLLAGEA
FT                   LTTEALRTWRRRHPDMTVHNVYGPTETTVSCADFPVEPGAELPPGTVPIGRPLAGTRIY
FT                   VLDSALAPVPPGVVGELYVAGSGLARGYLGRPGLSAERFVACPFGAPGERMYRTGDLAR
FT                   WRPTGVLDFMGRADQQVKVRGFRIEPGEIETVLAADPVVGQVSVVAREDRRGDQRLVAY
FT                   VVPVEGGTPESMDGSAVRERARRLLPEYMVPAAVVPLPALPLTPNGKLDRAALPAPPAG
FT                   VGKSCRGPGTPVEEVLCELFAEALGAEGIGADEGFFELGGHSLLAARLVGRIAARLGVE
FT                   VRLRDLFEAPTVAALARRLSRVGERDGTAFDVLLRLTAGGSGTPLFCVHPGGGISWCYT
FT                   GLIRHLPPDLPVYGLQSRALSPDTTCPATIEEMARDYREQIVSVQPVGPYRLLGWSFGG
FT                   LVAHAVAVQLQEAGEQVRFLGMLDSYPEFHDDGDRLPQWGDDGAVELLNEAIGGLDGLA
FT                   ADEMPRVLAALRHHRALWRGYVPRRYRGDLLFFTAALDRPEGRDAVREWNPFIDGTIEE
FT                   ISVECTHPAMLSPGPSARIGRALATALSPP"
     MGVRVADLIP LSFAQQRLWL IDRLEGPSAV YNVPLALRFS GAVNHGALEA ALRDVVVRHE        60
     SLRTVFTERA DKEEMAHQDI LGPEALSVPF EVGETHEGGL AEELEEFGAR PFDLAREIPV       120
     RARLLLLAPE ESVLALVIHH TACDGWSIGP LFRDLGTAYR ARCRPDGGAP QWAPLPVQYA       180
     DYALWQREML GDEDDPDSEV SRQSAFWSAE LTGLPEQLPL PADRARPAVS GFRGEAVPIE       240
     VGAEAHRVLT RLARDARASS FMVVQVALAL LLTRLGAGTD IPIGTVTAGR DEVALEELVG       300
     FFANTLVLRT DTSGNPTFRE LLERVRSRTL KAYAHGELPF ERVVELVRPG RSLARHPLFQ       360
     VMLVFQPEGD AVPDLPGLRV GLEEVDTPSA KFDLTLSLRE RFGRDGEPLG LSGELRYRTD       420
     LFDHGTSERM AARLVRILAA AARNPELPVG SIDILDAAER HRVLTEWNDT DLAAPTPSLP       480
     ALFSAQAART PAAPAVSDKG LVLTYAELDA RANRLAHLLA ARGIGPEKLV AVALPRSAQA       540
     VIALLAVLKA GGAYLPLDPG YPVERLGAML RDARPELVLT TGQADPTAES AIPRLCLDSS       600
     PVQAELESRP ATDPAVRTHP GHPVYVIYTS GSSGRPKGVV VTHGALADYL AWARRAYPAT       660
     AGTVLLHTSL SFDLTVTALW TPLTVGGCLF TASIAEIAEI AEIAEMRGND SGPAQSAGVV       720
     FTFVKATPSH LPLLAEASDI CSPTGQLLLA GEALTTEALR TWRRRHPDMT VHNVYGPTET       780
     TVSCADFPVE PGAELPPGTV PIGRPLAGTR IYVLDSALAP VPPGVVGELY VAGSGLARGY       840
     LGRPGLSAER FVACPFGAPG ERMYRTGDLA RWRPTGVLDF MGRADQQVKV RGFRIEPGEI       900
     ETVLAADPVV GQVSVVARED RRGDQRLVAY VVPVEGGTPE SMDGSAVRER ARRLLPEYMV       960
     PAAVVPLPAL PLTPNGKLDR AALPAPPAGV GKSCRGPGTP VEEVLCELFA EALGAEGIGA      1020
     DEGFFELGGH SLLAARLVGR IAARLGVEVR LRDLFEAPTV AALARRLSRV GERDGTAFDV      1080
     LLRLTAGGSG TPLFCVHPGG GISWCYTGLI RHLPPDLPVY GLQSRALSPD TTCPATIEEM      1140
     ARDYREQIVS VQPVGPYRLL GWSFGGLVAH AVAVQLQEAG EQVRFLGMLD SYPEFHDDGD      1200
     RLPQWGDDGA VELLNEAIGG LDGLAADEMP RVLAALRHHR ALWRGYVPRR YRGDLLFFTA      1260
     ALDRPEGRDA VREWNPFIDG TIEEISVECT HPAMLSPGPS ARIGRALATA LSPP            1314
//

If you have problems or comments...

PBIL Back to PBIL home page