(data stored in ACNUC7421 zone)

EMBL: CP002047.PE625

CP002047.PE625       Location/Qualifiers
FT   CDS             complement(801750..807356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00625"
FT                   /product="amino acid adenylation domain-containing protein"
FT                   /note="COG1020 Non-ribosomal peptide synthetase modules and
FT                   related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00625"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03746"
FT                   /db_xref="GOA:D7C292"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7C292"
FT                   /protein_id="ADI03746.1"
FT                   /translation="MADSAPHDLPLSFGQEQLWFLDRLRPGNSVHSVAAALRIRGDLDI
FT                   EALRRAFGEIVRRHDTLRACFPDRAGVPVWVPADSADLPLSFTDLGGLPEDRREPEAER
FT                   LLSEEADAPFDLASGPLIRLGLVRLSGEDHALAVTAHQIVLDSASMEVLLRELGQVYAA
FT                   FRDGRPPVLPTPLPRYADYAREQRGRSYTASLEYWRKQLDDVPTMLRLPCDRRRPAVRS
FT                   GRGAVQSFELGSELTTRLTGFSDSRGTTVATTVLAAFKTLLAHYCDQRDITVGTILPNR
FT                   PQGEPDSAVGQFANTVVLRSDLSGEPGFGEVLRRVDAAAREAAVHGDVPFEELIRVLQP
FT                   ERDPSSTPLFQVLFRASEGCEEAPEFAGLAVERIDLPRTSARFDLTLGVRHLGERLICE
FT                   LEYSTDLFEPATIRRMAGHLRQLLEDALAHPDRPVSALRLLLPAEREQILTGWNDTGSQ
FT                   GGVPRCLHTLFEEQVRRTPEALAVVWRDQRLTYRQLDERANQMAHALRSRGVGAETGVG
FT                   ICLERSAATLVALLAVFKAGGTFIPLDPDYPAERLAFMLSDSHASLLISDATTAAALTG
FT                   ADAVPALLIDRDDPEIRSQPTVPPVTGVLPSNLAGMLYTSGSTGTPKCAMLTHANFANY
FT                   FHSFEERYGLSRSLRAHLQMASFSFDMFMGDTMRALFTGATLVVCPREVSLSPPELLDL
FT                   MLQEGINSAEFVPPLLRVFLDHVEASGQSLEFLDFLMAGGDVWYVRDFERARRLCHPGT
FT                   VMAGTYGLTESAIDNTHFSEGHAGDDPEGALPVGRPLPGSRIYILNSALQPVPPGVAGE
FT                   LYVGGDGVGRGYFGRTALTATRFVPDPFSGVPGARLYRSGDLTRYRPDGTIEIVGRSDH
FT                   QVKVRGFRVELGEVEEALRGHPDVEDALVILHDKVPGDRHLVAYASVAAGRWPTSAETR
FT                   PAWERETRARLRDHLRGRLPGFMIPSAIVLLESMPLNSNGKLNRRGLPSPEKELSAQAG
FT                   GGAEPRTPAEEIIGGIWSAVIGLGGIGVHDNFFSIGGHSLLATQVLARIRTDLGAELPV
FT                   RAIYESPTIAGLAERAEASLRSGTPTTPPITSLPRVAGQRLPLSFAQRRLWFIDQLEPG
FT                   SPAYNIASPLRLRGALDREALRRSLEAMVERHEVLRTVFGSDDGEPWQEIRPAPSWELA
FT                   LTDLGGLGPGERTREAERLVSEEAMRPFDLVRGPLMRTELLRLAADEHILLLTMHHLVT
FT                   DGWSGSVFFEDLAALYAAGGHQERAGLTELPVSYADYAVWQRDWLRDGGLEHQLVYWKD
FT                   RLANAPAAIELPFDRPREAAGSSAGRVVEFRVPADVLDGIRAVSQASSATVFITLLAAF
FT                   HCLMGRLTGQDDIVVAVPTAARGRTELDRLVGFFVNTLALRADLSGNPTFRSLLDQVRR
FT                   VALDGYAHQDVPFEKIVEELNPDRSPWHNPLAQVLFVLQNNAPETAELTGLDVEPVPFD
FT                   VRTSQFDLGMQLWETDSGLQGMLSYRTELFDADTAERIISLWSTLLHSVAAAPDTRLSD
FT                   LPLSATRPLAPPPTGAQLPPPPIPDGQTVISLFDAQVRRTPDRIAVVYGATELTYAELG
FT                   ERVDQMAPVLREAGVGPELTVAVALPRSAHLVIATLAVLKAGGCCLPLDPGAPDERLEL
FT                   LPTDCPPVLTVTDRAHAWFLPADLPTLVIGEPRPATPPDVRTPSPQPAGAACVVRAAGE
FT                   HGEPLGAVLSHQDVLRVITGTGPCPGLGDVFDFTVWEWWGRLLRGSRVTVASRRPAGRA
FT                   ADTSTYPSADRPPGYVLDGAGRRVPPGVVGELYLPGPGPARGYPGRPALTAERFVADPY
FT                   GPPGGRMYRTGARARLRGDGSVDLVGRADQGGESAVASALPILADGPGDSIAG"
     MADSAPHDLP LSFGQEQLWF LDRLRPGNSV HSVAAALRIR GDLDIEALRR AFGEIVRRHD        60
     TLRACFPDRA GVPVWVPADS ADLPLSFTDL GGLPEDRREP EAERLLSEEA DAPFDLASGP       120
     LIRLGLVRLS GEDHALAVTA HQIVLDSASM EVLLRELGQV YAAFRDGRPP VLPTPLPRYA       180
     DYAREQRGRS YTASLEYWRK QLDDVPTMLR LPCDRRRPAV RSGRGAVQSF ELGSELTTRL       240
     TGFSDSRGTT VATTVLAAFK TLLAHYCDQR DITVGTILPN RPQGEPDSAV GQFANTVVLR       300
     SDLSGEPGFG EVLRRVDAAA REAAVHGDVP FEELIRVLQP ERDPSSTPLF QVLFRASEGC       360
     EEAPEFAGLA VERIDLPRTS ARFDLTLGVR HLGERLICEL EYSTDLFEPA TIRRMAGHLR       420
     QLLEDALAHP DRPVSALRLL LPAEREQILT GWNDTGSQGG VPRCLHTLFE EQVRRTPEAL       480
     AVVWRDQRLT YRQLDERANQ MAHALRSRGV GAETGVGICL ERSAATLVAL LAVFKAGGTF       540
     IPLDPDYPAE RLAFMLSDSH ASLLISDATT AAALTGADAV PALLIDRDDP EIRSQPTVPP       600
     VTGVLPSNLA GMLYTSGSTG TPKCAMLTHA NFANYFHSFE ERYGLSRSLR AHLQMASFSF       660
     DMFMGDTMRA LFTGATLVVC PREVSLSPPE LLDLMLQEGI NSAEFVPPLL RVFLDHVEAS       720
     GQSLEFLDFL MAGGDVWYVR DFERARRLCH PGTVMAGTYG LTESAIDNTH FSEGHAGDDP       780
     EGALPVGRPL PGSRIYILNS ALQPVPPGVA GELYVGGDGV GRGYFGRTAL TATRFVPDPF       840
     SGVPGARLYR SGDLTRYRPD GTIEIVGRSD HQVKVRGFRV ELGEVEEALR GHPDVEDALV       900
     ILHDKVPGDR HLVAYASVAA GRWPTSAETR PAWERETRAR LRDHLRGRLP GFMIPSAIVL       960
     LESMPLNSNG KLNRRGLPSP EKELSAQAGG GAEPRTPAEE IIGGIWSAVI GLGGIGVHDN      1020
     FFSIGGHSLL ATQVLARIRT DLGAELPVRA IYESPTIAGL AERAEASLRS GTPTTPPITS      1080
     LPRVAGQRLP LSFAQRRLWF IDQLEPGSPA YNIASPLRLR GALDREALRR SLEAMVERHE      1140
     VLRTVFGSDD GEPWQEIRPA PSWELALTDL GGLGPGERTR EAERLVSEEA MRPFDLVRGP      1200
     LMRTELLRLA ADEHILLLTM HHLVTDGWSG SVFFEDLAAL YAAGGHQERA GLTELPVSYA      1260
     DYAVWQRDWL RDGGLEHQLV YWKDRLANAP AAIELPFDRP REAAGSSAGR VVEFRVPADV      1320
     LDGIRAVSQA SSATVFITLL AAFHCLMGRL TGQDDIVVAV PTAARGRTEL DRLVGFFVNT      1380
     LALRADLSGN PTFRSLLDQV RRVALDGYAH QDVPFEKIVE ELNPDRSPWH NPLAQVLFVL      1440
     QNNAPETAEL TGLDVEPVPF DVRTSQFDLG MQLWETDSGL QGMLSYRTEL FDADTAERII      1500
     SLWSTLLHSV AAAPDTRLSD LPLSATRPLA PPPTGAQLPP PPIPDGQTVI SLFDAQVRRT      1560
     PDRIAVVYGA TELTYAELGE RVDQMAPVLR EAGVGPELTV AVALPRSAHL VIATLAVLKA      1620
     GGCCLPLDPG APDERLELLP TDCPPVLTVT DRAHAWFLPA DLPTLVIGEP RPATPPDVRT      1680
     PSPQPAGAAC VVRAAGEHGE PLGAVLSHQD VLRVITGTGP CPGLGDVFDF TVWEWWGRLL      1740
     RGSRVTVASR RPAGRAADTS TYPSADRPPG YVLDGAGRRV PPGVVGELYL PGPGPARGYP      1800
     GRPALTAERF VADPYGPPGG RMYRTGARAR LRGDGSVDLV GRADQGGESA VASALPILAD      1860
     GPGDSIAG                                                               1868
//

If you have problems or comments...

PBIL Back to PBIL home page