(data stored in ACNUC7421 zone)

EMBL: CP002047.PE626

CP002047.PE626       Location/Qualifiers
FT   CDS             complement(807455..808165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00626"
FT                   /product="hypothetical protein"
FT                   /note="COG2045 Phosphosulfolactate phosphohydrolase and
FT                   related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00626"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03747"
FT                   /db_xref="GOA:D7C293"
FT                   /db_xref="InterPro:IPR005238"
FT                   /db_xref="InterPro:IPR036702"
FT                   /db_xref="UniProtKB/TrEMBL:D7C293"
FT                   /protein_id="ADI03747.1"
FT                   /translation="MIGMDACFLGIAELVEAPSVAVVVDVMRAFTVAAWAFAQGAEKIV
FT                   LAESLDEALALKARHPDWVALKDGPPAPGFDMVNSPGLLRSVDLGGRTVVQKTTAGTVG
FT                   ALAVKEASLVLCAGFVVAEATARLLRTRKGDRVTFVVTGDDGQADEDLACAQYIARRAT
FT                   GAGTDAAEFVRRAAESRAAAELAEGVRQGAHSDDVALCLEVDRFPFAMVATLEGSLMVL
FT                   RPRAMQSLTDDAPI"
     MIGMDACFLG IAELVEAPSV AVVVDVMRAF TVAAWAFAQG AEKIVLAESL DEALALKARH        60
     PDWVALKDGP PAPGFDMVNS PGLLRSVDLG GRTVVQKTTA GTVGALAVKE ASLVLCAGFV       120
     VAEATARLLR TRKGDRVTFV VTGDDGQADE DLACAQYIAR RATGAGTDAA EFVRRAAESR       180
     AAAELAEGVR QGAHSDDVAL CLEVDRFPFA MVATLEGSLM VLRPRAMQSL TDDAPI           236
//

If you have problems or comments...

PBIL Back to PBIL home page