(data stored in ACNUC7421 zone)

EMBL: CP002047.PE630

CP002047.PE630       Location/Qualifiers
FT   CDS             complement(811721..812473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00630"
FT                   /product="hypothetical protein"
FT                   /note="COG1891 Uncharacterized protein conserved in
FT                   archaea"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00630"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03751"
FT                   /db_xref="GOA:D7C297"
FT                   /db_xref="InterPro:IPR007565"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="UniProtKB/TrEMBL:D7C297"
FT                   /protein_id="ADI03751.1"
FT                   /translation="MLLISPDSVEEALDCAKAAEHLDIVDVKKPDEGSLGANFPWVIRE
FT                   IRDAVPADKPVSATVGDVPYKPGTVAQAALGAVVSGATYIKVGLYGCTTPEQAIAVMRG
FT                   VVRAVKDYRPDAFVVASGYADASRIGCVNPLALPDIARRSGSDAAMLDTAIKDGTRLFD
FT                   HVPPDVCAEFVRLAHEADLLAALAGSVKVADLGALTRIGTDIVGVRGAVCQGGDRNTGR
FT                   IQPQLVAAFRAEMDRHAREHAAAVAPAS"
     MLLISPDSVE EALDCAKAAE HLDIVDVKKP DEGSLGANFP WVIREIRDAV PADKPVSATV        60
     GDVPYKPGTV AQAALGAVVS GATYIKVGLY GCTTPEQAIA VMRGVVRAVK DYRPDAFVVA       120
     SGYADASRIG CVNPLALPDI ARRSGSDAAM LDTAIKDGTR LFDHVPPDVC AEFVRLAHEA       180
     DLLAALAGSV KVADLGALTR IGTDIVGVRG AVCQGGDRNT GRIQPQLVAA FRAEMDRHAR       240
     EHAAAVAPAS                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page