(data stored in ACNUC7421 zone)

EMBL: CP002047.PE631

CP002047.PE631       Location/Qualifiers
FT   CDS             complement(812877..814055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00631"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03752"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D7C298"
FT                   /protein_id="ADI03752.1"
FT                   /translation="MNTEHDWITTPVTADILRGFLDVETTPHGLLPHRLPVRARRQIPD
FT                   NQLAVAEAQPSGVRLVFRTRATTIELDTLPTKRVYRGFPAPADGVYDLLVDGRLAAQAT
FT                   VAGGNVRTITDMVTQSSELSEGPAGTARFTDLPARDKEVEIWLPHTEITELIALRTDAP
FT                   VEPAPDSGRRVWLHHGSSISHGSNATHPTAIWPALAAARGGVELVNMGFGGSALLDPFT
FT                   ARAMRDTVADLISVKVGINVVNSDVMRLRAFAPAVHGFLDTIREGHPTTPLLVVSPILC
FT                   PVQEDTPGPLAPDFDGGTLRFKATGDPAERAAGRLTLNVIRAELARIVERRAADDPNLH
FT                   HLDGRDLYGETDYAEFPLPDEVHPDPAAHRRIAENFGRLAFGDGGPFATKPG"
     MNTEHDWITT PVTADILRGF LDVETTPHGL LPHRLPVRAR RQIPDNQLAV AEAQPSGVRL        60
     VFRTRATTIE LDTLPTKRVY RGFPAPADGV YDLLVDGRLA AQATVAGGNV RTITDMVTQS       120
     SELSEGPAGT ARFTDLPARD KEVEIWLPHT EITELIALRT DAPVEPAPDS GRRVWLHHGS       180
     SISHGSNATH PTAIWPALAA ARGGVELVNM GFGGSALLDP FTARAMRDTV ADLISVKVGI       240
     NVVNSDVMRL RAFAPAVHGF LDTIREGHPT TPLLVVSPIL CPVQEDTPGP LAPDFDGGTL       300
     RFKATGDPAE RAAGRLTLNV IRAELARIVE RRAADDPNLH HLDGRDLYGE TDYAEFPLPD       360
     EVHPDPAAHR RIAENFGRLA FGDGGPFATK PG                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page