(data stored in ACNUC7421 zone)

EMBL: CP002047.PE634

CP002047.PE634       Location/Qualifiers
FT   CDS             complement(815010..819215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00634"
FT                   /product="secreted glycosyl hydrolase"
FT                   /note="COG3979 Uncharacterized protein contain
FT                   chitin-binding domain type 3"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00634"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03755"
FT                   /db_xref="GOA:D7C2A1"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR011635"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR033801"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:D7C2A1"
FT                   /protein_id="ADI03755.1"
FT                   /translation="MVLGLPAVGAQAAGGPNAAADAPAKSGSAVGAHAAANVADGDADT
FT                   YWQAGKKSAQWVQTDLGRTERVRQVVLRLPADWQTRKQTLALQGSADGKSFATLKSSAQ
FT                   YVFSPGNGNTVKISFPATLTRYVRADFSKNSVASTGQLGEMQVFTAAASTPNLALGKTF
FT                   TESGHADVYGAANAGDGNRATYWESKNNAFPQWLQVDLGSSVKVNEVTLRLPSGWPSRS
FT                   QTLKIQGSTDNQNFTDLTASKAYTFDSGNDQSATIGFDTTTTRYVRVLITANSGWPAGQ
FT                   LSELEVYGPTTGDTQAPTAPTNLSYTEPATGQIKLTWNAATDDTGVTGYDIYAGGQLRA
FT                   SVAGNVLTYTDTQPADSDITYYVRAKDAAGNVSANSNSVTRKGTSGDTQAPTAPGNLAY
FT                   TQSGNDVKLTWQASTDNVKVTGYDVYAGGELAKSVAGDVTTYTDTPSAAATVTYYVKAK
FT                   DAAGNVSAASNSVTRPGSGSGSDLAQGKPIEASSYTFTYVAANANDGQTSTYWESAGGA
FT                   YPATLTTKLGANADLSQVVVKLNPDAAWSTRTQNIQVLGRDQDATAFTSLVAAKDYTFN
FT                   PSSGNTVTIPVTGAAADIQLKFTANSGAPGAQVAEFQVIGTPAANPDLKVTGITNTPAA
FT                   PVETDAVSLSATVTNSGTKASKATDLNFTLGGTKAATADVPALAAGESKTVTASIGTRD
FT                   AGSYAVGAEVDPSNKVIEQNEANNAFTRSDALVVKPVSSSDLVAAPVSWAPSSPSAGED
FT                   VKFTVAIKNQGTTASASGAHDVTLTIQDSKGATVKTLTGSYNGAIAAGQTTAPVSLGSW
FT                   TAANGKYTVKTVIADDANEVPVKRANNTTTQPLFVGRGANMPYDIYEAEDGTVGGGAKV
FT                   VGPNRTIGDFAGEASGRKAVTLGATGQYVEWTTRAATNTLVTRFSIPDGTNTTLNVYVD
FT                   GQFLKAIDLTSKYAWLYGNETAPGNSPGSGAPRHIYDEANLLLGKTVPAGSKIRLQKDA
FT                   ANTSTYAIDFINTEQATAASNPDPAAYAVPAGFSQQDVQNALDKVRMDTTGKLVGVYLP
FT                   AGDYETSSKFQVYGKAVKVVGAGPWFTRFHAPSSQENTDIGFRADATAKGSTFAGFAYF
FT                   GNYTSRIDGPGKVFDFAGVSDITIDNIWVEHMVCLYWGANTDNMTIQNSRIRDMFADGI
FT                   NMTNGSTDNHVVNNDARATGDDSFALFSAIDAGGADEKNNLYENLTSTLTWRAAGIAVY
FT                   GGYNNTFRNIRVADTLVYSGITISSLDFGYPMNGFGTEPTTIENVSLERTGGHFWGSQV
FT                   FPAIWAFSASKVFQGIRVNDVDIDDSTYGGVMFQTNYVGGQPQFPVKDTIFTDISITNS
FT                   KKSGDAFDAKSGFGIWANELPEPGQGPAVGEATFRNLRMSGNAQDIRNTTSTFRINVE"
     MVLGLPAVGA QAAGGPNAAA DAPAKSGSAV GAHAAANVAD GDADTYWQAG KKSAQWVQTD        60
     LGRTERVRQV VLRLPADWQT RKQTLALQGS ADGKSFATLK SSAQYVFSPG NGNTVKISFP       120
     ATLTRYVRAD FSKNSVASTG QLGEMQVFTA AASTPNLALG KTFTESGHAD VYGAANAGDG       180
     NRATYWESKN NAFPQWLQVD LGSSVKVNEV TLRLPSGWPS RSQTLKIQGS TDNQNFTDLT       240
     ASKAYTFDSG NDQSATIGFD TTTTRYVRVL ITANSGWPAG QLSELEVYGP TTGDTQAPTA       300
     PTNLSYTEPA TGQIKLTWNA ATDDTGVTGY DIYAGGQLRA SVAGNVLTYT DTQPADSDIT       360
     YYVRAKDAAG NVSANSNSVT RKGTSGDTQA PTAPGNLAYT QSGNDVKLTW QASTDNVKVT       420
     GYDVYAGGEL AKSVAGDVTT YTDTPSAAAT VTYYVKAKDA AGNVSAASNS VTRPGSGSGS       480
     DLAQGKPIEA SSYTFTYVAA NANDGQTSTY WESAGGAYPA TLTTKLGANA DLSQVVVKLN       540
     PDAAWSTRTQ NIQVLGRDQD ATAFTSLVAA KDYTFNPSSG NTVTIPVTGA AADIQLKFTA       600
     NSGAPGAQVA EFQVIGTPAA NPDLKVTGIT NTPAAPVETD AVSLSATVTN SGTKASKATD       660
     LNFTLGGTKA ATADVPALAA GESKTVTASI GTRDAGSYAV GAEVDPSNKV IEQNEANNAF       720
     TRSDALVVKP VSSSDLVAAP VSWAPSSPSA GEDVKFTVAI KNQGTTASAS GAHDVTLTIQ       780
     DSKGATVKTL TGSYNGAIAA GQTTAPVSLG SWTAANGKYT VKTVIADDAN EVPVKRANNT       840
     TTQPLFVGRG ANMPYDIYEA EDGTVGGGAK VVGPNRTIGD FAGEASGRKA VTLGATGQYV       900
     EWTTRAATNT LVTRFSIPDG TNTTLNVYVD GQFLKAIDLT SKYAWLYGNE TAPGNSPGSG       960
     APRHIYDEAN LLLGKTVPAG SKIRLQKDAA NTSTYAIDFI NTEQATAASN PDPAAYAVPA      1020
     GFSQQDVQNA LDKVRMDTTG KLVGVYLPAG DYETSSKFQV YGKAVKVVGA GPWFTRFHAP      1080
     SSQENTDIGF RADATAKGST FAGFAYFGNY TSRIDGPGKV FDFAGVSDIT IDNIWVEHMV      1140
     CLYWGANTDN MTIQNSRIRD MFADGINMTN GSTDNHVVNN DARATGDDSF ALFSAIDAGG      1200
     ADEKNNLYEN LTSTLTWRAA GIAVYGGYNN TFRNIRVADT LVYSGITISS LDFGYPMNGF      1260
     GTEPTTIENV SLERTGGHFW GSQVFPAIWA FSASKVFQGI RVNDVDIDDS TYGGVMFQTN      1320
     YVGGQPQFPV KDTIFTDISI TNSKKSGDAF DAKSGFGIWA NELPEPGQGP AVGEATFRNL      1380
     RMSGNAQDIR NTTSTFRINV E                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page