(data stored in ACNUC7421 zone)

EMBL: CP002047.PE635

CP002047.PE635       Location/Qualifiers
FT   CDS             complement(819716..821857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00635"
FT                   /product="hypothetical protein"
FT                   /note="COG3828 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00635"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03756"
FT                   /db_xref="GOA:D7C2A2"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR006584"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR026071"
FT                   /db_xref="InterPro:IPR029010"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D7C2A2"
FT                   /protein_id="ADI03756.1"
FT                   /translation="MFRSLRRTAAAALLALTAALLPSGGIAQAAGADAAYDVLVFSRTT
FT                   GFRHDSIPAGIDALRALGSANDFTVTATEDPAAFTQANLAGYEAVVFLSTTGDVLDDAQ
FT                   QNALQAHIDGGRGFVGVHAAADTEYDWGYYGDLVGARFKSHPAIQQASIVNEDRGHPAT
FT                   AHLGATWTRTDEWYNYQTNPRSSVHVLQSLDETSYSGGEMGDHPITWCHAQGAGRSFYT
FT                   GLGHTAESYADPAFRALLLGALRYASGAASADCSSSSSTTRTVEGEAFSSGSGVQIASH
FT                   APASGGQTLGYVDNGDWAGYSTVPTAGAARFSARVSSAGAGGTIDIRDGSAAGPVLGSV
FT                   TVPGTGGWETFTTVATDVKAGAGPLYLTFRGGSGALFDVDTLTVTYRTTSKALASNVHL
FT                   FYYPWYGSPAVLGSWRHWPQGGHTPPEDIGANYYPALGPYDSGDFTSAVARHMEWVKRS
FT                   GAGVIVYSWWGRDSYEDGLVRGVLDAAAAQGVKVAWHLEPYTGRTAASTVADINYLNNT
FT                   YGSHPAFYRDTAHGNKNAFYIFESLRITDWSPLDQVTDDSIVLAQTTDTTKIAHFSGMY
FT                   TYDGIAGATAPGWKQAGDYAKAHGLIWAPSVAPGYVDDRAVPGNTTPTLARDNGAAYDK
FT                   QWNNALDPQIGGSPTWVSVTSFNEWHEGSVIEPADSSPPAGHGYETYNGAYGRTGADAE
FT                   TAYLDRTAYWTGRFTGAGG"
     MFRSLRRTAA AALLALTAAL LPSGGIAQAA GADAAYDVLV FSRTTGFRHD SIPAGIDALR        60
     ALGSANDFTV TATEDPAAFT QANLAGYEAV VFLSTTGDVL DDAQQNALQA HIDGGRGFVG       120
     VHAAADTEYD WGYYGDLVGA RFKSHPAIQQ ASIVNEDRGH PATAHLGATW TRTDEWYNYQ       180
     TNPRSSVHVL QSLDETSYSG GEMGDHPITW CHAQGAGRSF YTGLGHTAES YADPAFRALL       240
     LGALRYASGA ASADCSSSSS TTRTVEGEAF SSGSGVQIAS HAPASGGQTL GYVDNGDWAG       300
     YSTVPTAGAA RFSARVSSAG AGGTIDIRDG SAAGPVLGSV TVPGTGGWET FTTVATDVKA       360
     GAGPLYLTFR GGSGALFDVD TLTVTYRTTS KALASNVHLF YYPWYGSPAV LGSWRHWPQG       420
     GHTPPEDIGA NYYPALGPYD SGDFTSAVAR HMEWVKRSGA GVIVYSWWGR DSYEDGLVRG       480
     VLDAAAAQGV KVAWHLEPYT GRTAASTVAD INYLNNTYGS HPAFYRDTAH GNKNAFYIFE       540
     SLRITDWSPL DQVTDDSIVL AQTTDTTKIA HFSGMYTYDG IAGATAPGWK QAGDYAKAHG       600
     LIWAPSVAPG YVDDRAVPGN TTPTLARDNG AAYDKQWNNA LDPQIGGSPT WVSVTSFNEW       660
     HEGSVIEPAD SSPPAGHGYE TYNGAYGRTG ADAETAYLDR TAYWTGRFTG AGG              713
//

If you have problems or comments...

PBIL Back to PBIL home page