(data stored in ACNUC7421 zone)

EMBL: CP002047.PE636

CP002047.PE636       Location/Qualifiers
FT   CDS             complement(821881..824730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00636"
FT                   /product="Glucose/sorbosone dehydrogenase-like protein"
FT                   /note="COG2133 Glucose/sorbosone dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00636"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03757"
FT                   /db_xref="GOA:D7C2A3"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR006584"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:D7C2A3"
FT                   /protein_id="ADI03757.1"
FT                   /translation="MPPRLHAVLHVIRPFTCVLALLIGGATAAAVPASAAPASQSAPAA
FT                   IPPSDYQQVQLATGPDELGEPMSLTVLPDRSVLHTARDGTVRITDAVGNTKVAGRLDVY
FT                   THDEEGLQGIAADPGFTTNRYVWVYYSPKLATPAGDAPTTGTAADFERWKGHLNLSRFT
FT                   LKSDGTLDLGSEKVALEVANDRGQCCHVGGDIDFDKDGNLYLTTGDDTNPFESSGYAPL
FT                   DERTDRNPQFDAQRSSGNTNDLRGKLLRIKPTADGGYTIPSGNLFAPGTANTRPEIYAM
FT                   GFRNPFRMSVDKPTGTVYLGDYGPDAGSTDSNRGPSGQVEFDRITGPGNFGWPYCTGTN
FT                   TTTETYTEYTFPSGPSGAKYDCAGGPANNSFRNTGLARLPAAKPSWIRYGGDAGSPPEF
FT                   GTGSESPMGGDVYRYDPNLDSSVKFPQSLDGHYFATEYGRKWIKAITVNGDGSPGSIED
FT                   FPWTGTQIIDSDFGPDGALYVLDYGTGGGNQALYRIEYVGGSNRNPVAEAAADRTSGQA
FT                   PLAVQFSSAGSSDPEGGALTYSWDFGDGSTSTAANPSHTYTANGTYRPTLTVRDPQGLT
FT                   GTASLVVTVGNTAPTVTLRTPGDGTLFTFGDTLPFTIEASDPEDGQVDCAKVKLTYLLG
FT                   HDSHEHQITSTNGCSGSITIPSDGEHDAAANLYGVLDATYTDAGGLTGHNKHILQPRHR
FT                   QAEHFTTQSGIQLASHAPAEGGQTVGFTDDGDWIAFKPYALTKATGITARVASGGAGGT
FT                   LEVRAGAPTGTLLGKATVSVTGGWETYTDVTAQLSGAASGTTELYLVFRGPTGQGNLFD
FT                   LDTFTLTSATSISQTVEGEAYTSGSGVQPAAHTSASGGQTLGYIDNGDSAGYTGVTTEG
FT                   ANSFSAKVSSAGPGGTIQIRSGSATGAVLGSVTVPTTGDWETFTTVGTGLSAGSGPLYL
FT                   TFSGGSGSLFDVDTFTVSR"
     MPPRLHAVLH VIRPFTCVLA LLIGGATAAA VPASAAPASQ SAPAAIPPSD YQQVQLATGP        60
     DELGEPMSLT VLPDRSVLHT ARDGTVRITD AVGNTKVAGR LDVYTHDEEG LQGIAADPGF       120
     TTNRYVWVYY SPKLATPAGD APTTGTAADF ERWKGHLNLS RFTLKSDGTL DLGSEKVALE       180
     VANDRGQCCH VGGDIDFDKD GNLYLTTGDD TNPFESSGYA PLDERTDRNP QFDAQRSSGN       240
     TNDLRGKLLR IKPTADGGYT IPSGNLFAPG TANTRPEIYA MGFRNPFRMS VDKPTGTVYL       300
     GDYGPDAGST DSNRGPSGQV EFDRITGPGN FGWPYCTGTN TTTETYTEYT FPSGPSGAKY       360
     DCAGGPANNS FRNTGLARLP AAKPSWIRYG GDAGSPPEFG TGSESPMGGD VYRYDPNLDS       420
     SVKFPQSLDG HYFATEYGRK WIKAITVNGD GSPGSIEDFP WTGTQIIDSD FGPDGALYVL       480
     DYGTGGGNQA LYRIEYVGGS NRNPVAEAAA DRTSGQAPLA VQFSSAGSSD PEGGALTYSW       540
     DFGDGSTSTA ANPSHTYTAN GTYRPTLTVR DPQGLTGTAS LVVTVGNTAP TVTLRTPGDG       600
     TLFTFGDTLP FTIEASDPED GQVDCAKVKL TYLLGHDSHE HQITSTNGCS GSITIPSDGE       660
     HDAAANLYGV LDATYTDAGG LTGHNKHILQ PRHRQAEHFT TQSGIQLASH APAEGGQTVG       720
     FTDDGDWIAF KPYALTKATG ITARVASGGA GGTLEVRAGA PTGTLLGKAT VSVTGGWETY       780
     TDVTAQLSGA ASGTTELYLV FRGPTGQGNL FDLDTFTLTS ATSISQTVEG EAYTSGSGVQ       840
     PAAHTSASGG QTLGYIDNGD SAGYTGVTTE GANSFSAKVS SAGPGGTIQI RSGSATGAVL       900
     GSVTVPTTGD WETFTTVGTG LSAGSGPLYL TFSGGSGSLF DVDTFTVSR                   949
//

If you have problems or comments...

PBIL Back to PBIL home page