(data stored in ACNUC7421 zone)

EMBL: CP002047.PE639

CP002047.PE639       Location/Qualifiers
FT   CDS             complement(827353..828012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00639"
FT                   /product="hypothetical protein"
FT                   /note="COG3173 Predicted aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00639"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03760"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D7C2A6"
FT                   /protein_id="ADI03760.1"
FT                   /translation="MADILRSAGYPAPATELAVQIDHAVVVVQELLPGAKIDDLDHRGL
FT                   EHALELNRLQTGRLADRLDIPPVGLHLSEDGSGYCLHEPLRRHNRRSAALERWITAVGE
FT                   DNPDQLVGYDAVHYDFHPGNMLAAGGAITGIVDWDGAGRGDRRFDLVTLRFGIHAKTCE
FT                   PGISKRLDDVLDAVPGDLLRLAWAHMSLRMVDWAIRHFAPADVEHWLDLAEQRAYQ"
     MADILRSAGY PAPATELAVQ IDHAVVVVQE LLPGAKIDDL DHRGLEHALE LNRLQTGRLA        60
     DRLDIPPVGL HLSEDGSGYC LHEPLRRHNR RSAALERWIT AVGEDNPDQL VGYDAVHYDF       120
     HPGNMLAAGG AITGIVDWDG AGRGDRRFDL VTLRFGIHAK TCEPGISKRL DDVLDAVPGD       180
     LLRLAWAHMS LRMVDWAIRH FAPADVEHWL DLAEQRAYQ                              219
//

If you have problems or comments...

PBIL Back to PBIL home page