(data stored in ACNUC7421 zone)

EMBL: CP002047.PE64

CP002047.PE64        Location/Qualifiers
FT   CDS             58674..59042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00064"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03185"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUJ4"
FT                   /protein_id="ADI03185.1"
FT                   /translation="MNINLSAVIIDAADLEPESAFWHRLLSGSIVKTATHHFLRIDGFP
FT                   VFVIQLAPGHVPPQWPKGNSQQMHVDLTTDDLAAADRLALEAGARRLHPTDDVDPASQK
FT                   GGRVYASPAGHPFCLRSG"
     MNINLSAVII DAADLEPESA FWHRLLSGSI VKTATHHFLR IDGFPVFVIQ LAPGHVPPQW        60
     PKGNSQQMHV DLTTDDLAAA DRLALEAGAR RLHPTDDVDP ASQKGGRVYA SPAGHPFCLR       120
     SG                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page