(data stored in ACNUC7421 zone)

EMBL: CP002047.PE640

CP002047.PE640       Location/Qualifiers
FT   CDS             complement(828661..829458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00640"
FT                   /product="hypothetical protein"
FT                   /note="COG0454 Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00640"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03761"
FT                   /db_xref="GOA:D7C2A7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D7C2A7"
FT                   /protein_id="ADI03761.1"
FT                   /translation="MDHEEVLALFDRQMRRDAQPDGPGARVERDGDVVRHVGADHDWNG
FT                   VLWSDLDDATADAAIAAQVRYFGTLGREFEWKAYAHDRPGDLGRRLRSAGFTAEPEEAV
FT                   MVARVQDLPTDIALPEGVRLLPVTDPAGVDLVVDVHEQAFGTSGASLRQRLLTQLAQNS
FT                   ETVSMVVAMAGDLPVCSARMELNPATEFAGLWGGGTVAAWRGRGIYRALVAHRARIAAD
FT                   LGYRYLQVDATDQSRPILQRLGFAILSTTAPYVYQPQHNDREA"
     MDHEEVLALF DRQMRRDAQP DGPGARVERD GDVVRHVGAD HDWNGVLWSD LDDATADAAI        60
     AAQVRYFGTL GREFEWKAYA HDRPGDLGRR LRSAGFTAEP EEAVMVARVQ DLPTDIALPE       120
     GVRLLPVTDP AGVDLVVDVH EQAFGTSGAS LRQRLLTQLA QNSETVSMVV AMAGDLPVCS       180
     ARMELNPATE FAGLWGGGTV AAWRGRGIYR ALVAHRARIA ADLGYRYLQV DATDQSRPIL       240
     QRLGFAILST TAPYVYQPQH NDREA                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page