(data stored in ACNUC7421 zone)

EMBL: CP002047.PE641

CP002047.PE641       Location/Qualifiers
FT   CDS             829351..829476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00641"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03762"
FT                   /db_xref="UniProtKB/TrEMBL:D7C2A8"
FT                   /protein_id="ADI03762.1"
FT                   /translation="MPHDVAVTLDAGSGTVGLRVAPHLAVEQGEHFFVIHPPTPA"
     MPHDVAVTLD AGSGTVGLRV APHLAVEQGE HFFVIHPPTP A                            41
//

If you have problems or comments...

PBIL Back to PBIL home page