(data stored in ACNUC7421 zone)

EMBL: CP002047.PE643

CP002047.PE643       Location/Qualifiers
FT   CDS             complement(830117..833563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00643"
FT                   /product="WGR domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00643"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03764"
FT                   /db_xref="InterPro:IPR025406"
FT                   /db_xref="UniProtKB/TrEMBL:D7C2B0"
FT                   /protein_id="ADI03764.1"
FT                   /translation="MPDAGDTGHAEDAAAAPDEDSFTLPAAWRQSLRPRWGGITRYTHA
FT                   PHESALDSWDRRLAAAKEEWTGTVLGGAVPGIAPEPAAAARRYLEGTADPVGAAVLAVV
FT                   TDRGKLLYDHVADAWHLRHGRVFAARATVELFELDREDNLGSTTRPAVLPEGDSPQQLW
FT                   LRRGAADRVRTLLSMADEGQYREVVAALAAHRGGARRRIVVSYLVPGETGWVAECCADP
FT                   GESGREDRVVRAMLFESLNDEEQLRALLRAGGVSAYDGRLATAATVAEGVGPAVAALIA
FT                   EIWRHRTPSYGASAEEQAGILAELPTDEAFELLMAHADDKQVRPALLEAVRRYPVRAAR
FT                   LLAGRAAPAPGRNSFLLGQLLTAHVATHGELLEPRLAQFPPKAAEVVRELLHPAAADAP
FT                   ADALPELLVSPPWTGRRTAPKPRTVKGLVAGEETRMLWQPGEREAWAGAVEEPRRRVRR
FT                   RQNEPYPDVRTVCEQFTDLDNYRLAALFADGPDTYRPLLAQWTPEHMWELVKELKPVAA
FT                   RWAEDALPPLLHAAARQPAVAGGLLLPYRQLEVARLMADWFVRLKSAAATTRAWFARHG
FT                   ADAAALLVPDAAGPAGAARHSAEHALRAIAATHGKDAVLDAAAGHGPEAVAVVRDLLSA
FT                   DRLELALPSRMPEPAAWAAPRLLPRVLLRERTSALPAESVRHLLTMLAISRPGAVYTGV
FT                   EVVKEACDPESLAAFAWSLFEQWRLSGMPAKESWALHALGWLGDDDTVRRLAPVLRNWP
FT                   GEGAHQRAVEGLDVLAAIGSDVALMHLHGVSERVKFKALKTRAKEKIEQVAADLGLSGE
FT                   ELADRLVPDFGLDADGSTVVDYGPRRFTVGFDEQLRPYFLDQDGKRRKDLPKPGAHDDA
FT                   ELAPAERKRFMALKKDVRTVASDQVRRLEGAMVAGRSWTTGEFRELFVSHPLLWHLVRR
FT                   LVWLCIPARASERALYETPAISGAGAATAVTAVTAFRVAEDRTFADVRDEEFSLPNDAS
FT                   VRPAHPLHLGEELTEWEELFADHGILQPFPQLGRAVHRLTDDEAARDRLERFENITVPT
FT                   AKLLGLERRGWERDEPMFAGVQCWLSKQVAKDRWIIVSPSEGFTLGAVDVSTEQSLEFI
FT                   GLSEQPSAWDPPGEPSRLAFAELDPVTASELLADLTELVAR"
     MPDAGDTGHA EDAAAAPDED SFTLPAAWRQ SLRPRWGGIT RYTHAPHESA LDSWDRRLAA        60
     AKEEWTGTVL GGAVPGIAPE PAAAARRYLE GTADPVGAAV LAVVTDRGKL LYDHVADAWH       120
     LRHGRVFAAR ATVELFELDR EDNLGSTTRP AVLPEGDSPQ QLWLRRGAAD RVRTLLSMAD       180
     EGQYREVVAA LAAHRGGARR RIVVSYLVPG ETGWVAECCA DPGESGREDR VVRAMLFESL       240
     NDEEQLRALL RAGGVSAYDG RLATAATVAE GVGPAVAALI AEIWRHRTPS YGASAEEQAG       300
     ILAELPTDEA FELLMAHADD KQVRPALLEA VRRYPVRAAR LLAGRAAPAP GRNSFLLGQL       360
     LTAHVATHGE LLEPRLAQFP PKAAEVVREL LHPAAADAPA DALPELLVSP PWTGRRTAPK       420
     PRTVKGLVAG EETRMLWQPG EREAWAGAVE EPRRRVRRRQ NEPYPDVRTV CEQFTDLDNY       480
     RLAALFADGP DTYRPLLAQW TPEHMWELVK ELKPVAARWA EDALPPLLHA AARQPAVAGG       540
     LLLPYRQLEV ARLMADWFVR LKSAAATTRA WFARHGADAA ALLVPDAAGP AGAARHSAEH       600
     ALRAIAATHG KDAVLDAAAG HGPEAVAVVR DLLSADRLEL ALPSRMPEPA AWAAPRLLPR       660
     VLLRERTSAL PAESVRHLLT MLAISRPGAV YTGVEVVKEA CDPESLAAFA WSLFEQWRLS       720
     GMPAKESWAL HALGWLGDDD TVRRLAPVLR NWPGEGAHQR AVEGLDVLAA IGSDVALMHL       780
     HGVSERVKFK ALKTRAKEKI EQVAADLGLS GEELADRLVP DFGLDADGST VVDYGPRRFT       840
     VGFDEQLRPY FLDQDGKRRK DLPKPGAHDD AELAPAERKR FMALKKDVRT VASDQVRRLE       900
     GAMVAGRSWT TGEFRELFVS HPLLWHLVRR LVWLCIPARA SERALYETPA ISGAGAATAV       960
     TAVTAFRVAE DRTFADVRDE EFSLPNDASV RPAHPLHLGE ELTEWEELFA DHGILQPFPQ      1020
     LGRAVHRLTD DEAARDRLER FENITVPTAK LLGLERRGWE RDEPMFAGVQ CWLSKQVAKD      1080
     RWIIVSPSEG FTLGAVDVST EQSLEFIGLS EQPSAWDPPG EPSRLAFAEL DPVTASELLA      1140
     DLTELVAR                                                               1148
//

If you have problems or comments...

PBIL Back to PBIL home page