(data stored in ACNUC7421 zone)

EMBL: CP002047.PE67

CP002047.PE67        Location/Qualifiers
FT   CDS             complement(61081..61947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00067"
FT                   /product="DNA-binding protein"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00067"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03188"
FT                   /db_xref="GOA:D7BUJ7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUJ7"
FT                   /protein_id="ADI03188.1"
FT                   /translation="MSSSNAHHSELGAFLKARRTELGPAQVGLPDSAGRRRVKGLRREE
FT                   VALLASISPDYYTRLEQGRRQASEPVLDALARVLRLDDGERAYMFELSGRDAARPRRRA
FT                   TQKVHPQLQRLLDDLPTTPAVVLGRRTDILAWNPMAAALFTDFARIPEGNRNFVRLVFC
FT                   EPAIRTLYPDWDWVAQISLAQLRMEAARDPKDPRLAVLVGELSLQDPDFRRWWGAHHVA
FT                   VQGTGTKTLNHPVVGRLTLDWSFLTCADDPDQQLITLTAEPGTPSHDRLRILASHATQA
FT                   DREGRRS"
     MSSSNAHHSE LGAFLKARRT ELGPAQVGLP DSAGRRRVKG LRREEVALLA SISPDYYTRL        60
     EQGRRQASEP VLDALARVLR LDDGERAYMF ELSGRDAARP RRRATQKVHP QLQRLLDDLP       120
     TTPAVVLGRR TDILAWNPMA AALFTDFARI PEGNRNFVRL VFCEPAIRTL YPDWDWVAQI       180
     SLAQLRMEAA RDPKDPRLAV LVGELSLQDP DFRRWWGAHH VAVQGTGTKT LNHPVVGRLT       240
     LDWSFLTCAD DPDQQLITLT AEPGTPSHDR LRILASHATQ ADREGRRS                    288
//

If you have problems or comments...

PBIL Back to PBIL home page