(data stored in ACNUC7421 zone)

EMBL: CP002047.PE68

CP002047.PE68        Location/Qualifiers
FT   CDS             62123..63088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00068"
FT                   /product="hypothetical protein"
FT                   /note="COG1073 Hydrolases of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00068"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03189"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUJ8"
FT                   /protein_id="ADI03189.1"
FT                   /translation="MSAVTALLICTQETQNVKTSVTFPSNNLAVAGILFTPDDHIDGRL
FT                   PAIVISHPGGGVKEQSPSIYAERLAREGFAALVFDAAYQGESEGEPRGMENPFQRAEDI
FT                   KSAVTYLTTRDDIAPDRIGALGICASGGYVPYAAQTDHRIKGIATVSAVDLGSVFREGL
FT                   GRTQDLAVLKAMLDRSGALRTEEARGAAPQLEAWIPDNAEELLETATRQFRETFEYYRT
FT                   PRGYHPRAVQGWVLRSIDLIAQYDSYAMIRLISPRPLLMIAGSEAESAYFSREAIEKAA
FT                   EPKELVVIDGATHIDLYDKDEYVTPAVAKLTEFFGKHLAG"
     MSAVTALLIC TQETQNVKTS VTFPSNNLAV AGILFTPDDH IDGRLPAIVI SHPGGGVKEQ        60
     SPSIYAERLA REGFAALVFD AAYQGESEGE PRGMENPFQR AEDIKSAVTY LTTRDDIAPD       120
     RIGALGICAS GGYVPYAAQT DHRIKGIATV SAVDLGSVFR EGLGRTQDLA VLKAMLDRSG       180
     ALRTEEARGA APQLEAWIPD NAEELLETAT RQFRETFEYY RTPRGYHPRA VQGWVLRSID       240
     LIAQYDSYAM IRLISPRPLL MIAGSEAESA YFSREAIEKA AEPKELVVID GATHIDLYDK       300
     DEYVTPAVAK LTEFFGKHLA G                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page