(data stored in ACNUC7421 zone)

EMBL: CP002047.PE69

CP002047.PE69        Location/Qualifiers
FT   CDS             complement(63342..63842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00069"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03190"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUJ9"
FT                   /protein_id="ADI03190.1"
FT                   /translation="MFLGEFLKAEADSILCAVGGSDGWVGAGQGLGAWCLAGQLGTLVG
FT                   VEGGFQGGDVVGGDAAPGLLEPADGGHLGDDGLQAAVGGSEHDRVSAGTAGYLQSDPVG
FT                   VDFGASANVPARRRSAIWASPHTSWAPPMGGYDTCATRRWALQHLCEPLTRDETGIPPR
FT                   QLP"
     MFLGEFLKAE ADSILCAVGG SDGWVGAGQG LGAWCLAGQL GTLVGVEGGF QGGDVVGGDA        60
     APGLLEPADG GHLGDDGLQA AVGGSEHDRV SAGTAGYLQS DPVGVDFGAS ANVPARRRSA       120
     IWASPHTSWA PPMGGYDTCA TRRWALQHLC EPLTRDETGI PPRQLP                      166
//

If you have problems or comments...

PBIL Back to PBIL home page