(data stored in ACNUC7421 zone)

EMBL: CP002047.PE7

CP002047.PE7         Location/Qualifiers
FT   CDS             complement(7419..8045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00007"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03128"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSV1"
FT                   /protein_id="ADI03128.1"
FT                   /translation="MPIACTAATVNAVCLAEQATVLLPVLVDAHRNGTDHWMTEGYAGY
FT                   NSPERELVLRTFITLAADGSTGPLTAHLRTFAHNANALQQLLHHAATHFTYDARLRAPL
FT                   PSVWPLILTTVLDALDAGTTLYADNSRWAEYAIAALLPTPQLRTADLDPDNTLNRANRD
FT                   WLTPGALGDAAARWLDLTRGEPKAAGALARFARTTPPPGSAPGLT"
     MPIACTAATV NAVCLAEQAT VLLPVLVDAH RNGTDHWMTE GYAGYNSPER ELVLRTFITL        60
     AADGSTGPLT AHLRTFAHNA NALQQLLHHA ATHFTYDARL RAPLPSVWPL ILTTVLDALD       120
     AGTTLYADNS RWAEYAIAAL LPTPQLRTAD LDPDNTLNRA NRDWLTPGAL GDAAARWLDL       180
     TRGEPKAAGA LARFARTTPP PGSAPGLT                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page