(data stored in ACNUC7421 zone)

EMBL: CP002047.PE70

CP002047.PE70        Location/Qualifiers
FT   CDS             64296..64931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00070"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03191"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUK0"
FT                   /protein_id="ADI03191.1"
FT                   /translation="MVDTSTDNTNLKSQYAAQITADLERNSTEHERLSTEISALQRQLS
FT                   VLENNRVLLLSMRQTLGGGTAADVPGNTGVSSSEDESSAARESATLPAARKPAKKTNTA
FT                   TGKRKGAESDGSRPKRVRETGVPTLRDLIRDDLIQHGEPRSAAEVTTALTQALPDREIK
FT                   ATVVRSTLESLVAKGQVHRTKQQKSVFYSVTAPDTAAGTSEPSTASAS"
     MVDTSTDNTN LKSQYAAQIT ADLERNSTEH ERLSTEISAL QRQLSVLENN RVLLLSMRQT        60
     LGGGTAADVP GNTGVSSSED ESSAARESAT LPAARKPAKK TNTATGKRKG AESDGSRPKR       120
     VRETGVPTLR DLIRDDLIQH GEPRSAAEVT TALTQALPDR EIKATVVRST LESLVAKGQV       180
     HRTKQQKSVF YSVTAPDTAA GTSEPSTASA S                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page