(data stored in ACNUC7421 zone)

EMBL: CP002047.PE71

CP002047.PE71        Location/Qualifiers
FT   CDS             65648..66004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00071"
FT                   /product="YCII-related protein"
FT                   /note="COG3795 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00071"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03192"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUK1"
FT                   /protein_id="ADI03192.1"
FT                   /translation="MMRFVLVIHQGTYPLPGTPQAELVSEEDRKAAYADWAAIGKMENV
FT                   TGAPPMGLPKDATTVRVEDGSAVATEGPFDNTSVGGFLVVEAEDLDSAIAIASRVPQAR
FT                   LGGAVEVRPSAKYW"
     MMRFVLVIHQ GTYPLPGTPQ AELVSEEDRK AAYADWAAIG KMENVTGAPP MGLPKDATTV        60
     RVEDGSAVAT EGPFDNTSVG GFLVVEAEDL DSAIAIASRV PQARLGGAVE VRPSAKYW         118
//

If you have problems or comments...

PBIL Back to PBIL home page