(data stored in ACNUC7421 zone)

EMBL: CP002047.PE73

CP002047.PE73        Location/Qualifiers
FT   CDS             66175..67035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00073"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03194"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUK3"
FT                   /protein_id="ADI03194.1"
FT                   /translation="MTSDQHADRAVDQDGTQFATAGRTGLFGHRRRTTDDAWLPGGTEL
FT                   GTLHDIGVEDLDEGVEIGSPRRRVERVDHLPLTREIPIGPGNLRAVDPTPRSAGELPCG
FT                   RGVSVDDVGDLVEGQVEHVVQHERQPFCRGEPFEYDKRRQAHRVGQQCLLLGVGVSSPD
FT                   DRVGQVLDQRVFPAAPSGSQLVQALPRDDGGQPRLGGRPRLLRPGQGGDRWAMRVGTGQ
FT                   TAGRTARHRRSTGHRRLLPAAIALPTTAKTTLVLQFDGKGIVVRPETLRPATLKAHRTR
FT                   PPCGR"
     MTSDQHADRA VDQDGTQFAT AGRTGLFGHR RRTTDDAWLP GGTELGTLHD IGVEDLDEGV        60
     EIGSPRRRVE RVDHLPLTRE IPIGPGNLRA VDPTPRSAGE LPCGRGVSVD DVGDLVEGQV       120
     EHVVQHERQP FCRGEPFEYD KRRQAHRVGQ QCLLLGVGVS SPDDRVGQVL DQRVFPAAPS       180
     GSQLVQALPR DDGGQPRLGG RPRLLRPGQG GDRWAMRVGT GQTAGRTARH RRSTGHRRLL       240
     PAAIALPTTA KTTLVLQFDG KGIVVRPETL RPATLKAHRT RPPCGR                      286
//

If you have problems or comments...

PBIL Back to PBIL home page