(data stored in ACNUC7421 zone)

EMBL: CP002047.PE74

CP002047.PE74        Location/Qualifiers
FT   CDS             complement(67602..68735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00074"
FT                   /product="putative transcriptional regulator, TetR family
FT                   protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00074"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03195"
FT                   /db_xref="GOA:D7BUK4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUK4"
FT                   /protein_id="ADI03195.1"
FT                   /translation="MARLTRAQQQERTRAAVLVAAREEFAEHGYAEAKVDRIAERAELT
FT                   RGAVYSNFTGKRALYLAVLADAAERARARAEPPMESPDSVGRALGTFARVWLERLPLAG
FT                   DTPGSGHLQLRSLSGVLDTEPARTALAELVRFEALLLALALESRPAARGRMVRPAQLAL
FT                   TLLHGAAGLAENAPGVGDPFDLARAAEHLADIALNDDAEPPHLPFIPRAQPAEDPWAAP
FT                   RGLADEITGRAVDLTDDGVVVLLGVSRLSAAEEAVRSARPRDAVTIVVTTSDPAETGRL
FT                   ARLRIADLVACLRRVFAAEELPRPRIVFDDGGTVPAALGRTSVDDLTEIAIRVRDGLIV
FT                   AHAEGRGAGHAVADSGAPHRGRGTTTPSRRDLRTRPE"
     MARLTRAQQQ ERTRAAVLVA AREEFAEHGY AEAKVDRIAE RAELTRGAVY SNFTGKRALY        60
     LAVLADAAER ARARAEPPME SPDSVGRALG TFARVWLERL PLAGDTPGSG HLQLRSLSGV       120
     LDTEPARTAL AELVRFEALL LALALESRPA ARGRMVRPAQ LALTLLHGAA GLAENAPGVG       180
     DPFDLARAAE HLADIALNDD AEPPHLPFIP RAQPAEDPWA APRGLADEIT GRAVDLTDDG       240
     VVVLLGVSRL SAAEEAVRSA RPRDAVTIVV TTSDPAETGR LARLRIADLV ACLRRVFAAE       300
     ELPRPRIVFD DGGTVPAALG RTSVDDLTEI AIRVRDGLIV AHAEGRGAGH AVADSGAPHR       360
     GRGTTTPSRR DLRTRPE                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page