(data stored in ACNUC7421 zone)

EMBL: CP002047.PE79

CP002047.PE79        Location/Qualifiers
FT   CDS             72156..73145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00079"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03200"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUK9"
FT                   /protein_id="ADI03200.1"
FT                   /translation="MTDSTPPPWVDDLFPFPTPPALRTLIDIAWQDAYDFYRENESFDC
FT                   TLLEMHYDFMFDLAKTPRPPDGCDAYPEIDNQDRQLLVPHFATPEFVPFGSLGDGGYIG
FT                   WLVPAPELSRLDHPVALANGHEHGVTLIGTDTRTGLEFMLSRALRRWRQEPDTEPPAGR
FT                   DPDVWLAQNQWRINARVKDRQLADRLAAELRVHPDPDRTFPGSRWNGTAVMQDTEFDIV
FT                   FDVPEGWRHEPGADGIGVLAPADAYNDREPVVYVSSWESSLEPALADAERLLDTGHPAT
FT                   ALLGLKDIFVNAPSGHFADLKPLWARAYRDLGRAEYAERLDLMTPMYQ"
     MTDSTPPPWV DDLFPFPTPP ALRTLIDIAW QDAYDFYREN ESFDCTLLEM HYDFMFDLAK        60
     TPRPPDGCDA YPEIDNQDRQ LLVPHFATPE FVPFGSLGDG GYIGWLVPAP ELSRLDHPVA       120
     LANGHEHGVT LIGTDTRTGL EFMLSRALRR WRQEPDTEPP AGRDPDVWLA QNQWRINARV       180
     KDRQLADRLA AELRVHPDPD RTFPGSRWNG TAVMQDTEFD IVFDVPEGWR HEPGADGIGV       240
     LAPADAYNDR EPVVYVSSWE SSLEPALADA ERLLDTGHPA TALLGLKDIF VNAPSGHFAD       300
     LKPLWARAYR DLGRAEYAER LDLMTPMYQ                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page