(data stored in ACNUC7421 zone)

EMBL: CP002047.PE8

CP002047.PE8         Location/Qualifiers
FT   CDS             complement(8057..8422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00008"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03129"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSV2"
FT                   /protein_id="ADI03129.1"
FT                   /translation="MYPMAASGSAARALPSLLLAPSDHLGIDRDRIEETATALAASPDG
FT                   IRTLFAAGCAPVWEAPCEEEADKGIPCPRHQPLWAAVQAGLGGCRLGPWLSGSRQPEVL
FT                   PPPTPTPCPSYPPPTCS"
     MYPMAASGSA ARALPSLLLA PSDHLGIDRD RIEETATALA ASPDGIRTLF AAGCAPVWEA        60
     PCEEEADKGI PCPRHQPLWA AVQAGLGGCR LGPWLSGSRQ PEVLPPPTPT PCPSYPPPTC       120
     S                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page