(data stored in ACNUC7421 zone)

EMBL: CP002047.PE80

CP002047.PE80        Location/Qualifiers
FT   CDS             complement(73188..73970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00080"
FT                   /product="hypothetical protein"
FT                   /note="COG4312 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03201"
FT                   /db_xref="InterPro:IPR010296"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUL0"
FT                   /protein_id="ADI03201.1"
FT                   /translation="MTTTPNEPTTALPGRPPVVDLATWQAARDELLVREKAHTREGDAL
FT                   AAARRRLPMVELDGTVEVVGPDGPVPFLDLFQGRDELVVYKHMWYDGAPHQGQCEGCTT
FT                   TAWHLKDAAYLNARGVSFAVLTTGRWDEVASYVAFMGYTQPWYSVRGVDVPVGGDMGYL
FT                   TCFLREGDRVFLTYSTTGRGNERVNGSMGLLDMTPYGRGEAWEDNPQDWPQGGSPCWSW
FT                   RSDAEGNATWGPTSRPVPQWTRPGATPVETLGRHSHHH"
     MTTTPNEPTT ALPGRPPVVD LATWQAARDE LLVREKAHTR EGDALAAARR RLPMVELDGT        60
     VEVVGPDGPV PFLDLFQGRD ELVVYKHMWY DGAPHQGQCE GCTTTAWHLK DAAYLNARGV       120
     SFAVLTTGRW DEVASYVAFM GYTQPWYSVR GVDVPVGGDM GYLTCFLREG DRVFLTYSTT       180
     GRGNERVNGS MGLLDMTPYG RGEAWEDNPQ DWPQGGSPCW SWRSDAEGNA TWGPTSRPVP       240
     QWTRPGATPV ETLGRHSHHH                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page