(data stored in ACNUC7421 zone)

EMBL: CP002047.PE83

CP002047.PE83        Location/Qualifiers
FT   CDS             complement(76275..76859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00083"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03204"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUL3"
FT                   /protein_id="ADI03204.1"
FT                   /translation="MPATAMVPVAQIFRRDAPGPWWPAGIDLLQILWCPNEHWDPPAPQ
FT                   ADVSPVLEVRWRRAADVVDPLTTPPPPSRYEEDGCLPQACAITAERVTDFPFREELPAE
FT                   LRPRLEELVRETGDGGDAITRLAGWKLGGWPTWHLNQPTVFACGDCGTAMTLLFTVASD
FT                   DETGVVVGRWGDLRIFTCPADYRHAFWVDLH"
     MPATAMVPVA QIFRRDAPGP WWPAGIDLLQ ILWCPNEHWD PPAPQADVSP VLEVRWRRAA        60
     DVVDPLTTPP PPSRYEEDGC LPQACAITAE RVTDFPFREE LPAELRPRLE ELVRETGDGG       120
     DAITRLAGWK LGGWPTWHLN QPTVFACGDC GTAMTLLFTV ASDDETGVVV GRWGDLRIFT       180
     CPADYRHAFW VDLH                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page