(data stored in ACNUC7421 zone)

EMBL: CP002047.PE86

CP002047.PE86        Location/Qualifiers
FT   CDS             complement(79551..80450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00086"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00086"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03207"
FT                   /db_xref="GOA:D7BUL6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUL6"
FT                   /protein_id="ADI03207.1"
FT                   /translation="MDDLETRELRYFVAVAEELHFGRAAGRLGIAQPPLSRAIRRLEQR
FT                   LGVQLLDRDRRGAALTEAGRVLLREARVALDAVAAAARRTRRAGDPKRPLVLATKTGAS
FT                   HELLRRLLDTLASEPGAAPIEVLLCEVGEQARLLRDGQADVALMHRPFDDLAGFDTEDL
FT                   RVEGQVAILPAGHPLASCHQLTLADVSNVPHLPIARWPRLDGSYPDGPGPEVHTQSQLA
FT                   QLVALGKTLLVIPASSRAWQWPEHVAVPVVDAPKVTTVIAWPQSSRSQEVASLVRSAAG
FT                   LRGGWGVVQVDHRAYGRR"
     MDDLETRELR YFVAVAEELH FGRAAGRLGI AQPPLSRAIR RLEQRLGVQL LDRDRRGAAL        60
     TEAGRVLLRE ARVALDAVAA AARRTRRAGD PKRPLVLATK TGASHELLRR LLDTLASEPG       120
     AAPIEVLLCE VGEQARLLRD GQADVALMHR PFDDLAGFDT EDLRVEGQVA ILPAGHPLAS       180
     CHQLTLADVS NVPHLPIARW PRLDGSYPDG PGPEVHTQSQ LAQLVALGKT LLVIPASSRA       240
     WQWPEHVAVP VVDAPKVTTV IAWPQSSRSQ EVASLVRSAA GLRGGWGVVQ VDHRAYGRR        299
//

If you have problems or comments...

PBIL Back to PBIL home page