(data stored in ACNUC7421 zone)

EMBL: CP002047.PE88

CP002047.PE88        Location/Qualifiers
FT   CDS             81393..81776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00088"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03209"
FT                   /db_xref="GOA:D7BUL8"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUL8"
FT                   /protein_id="ADI03209.1"
FT                   /translation="MFTSLATEWPWLLAVIALVIHCSAMAKWVPIQRFWTVYPFIWVLC
FT                   GVGAVAIGSSQGFALTDMLVLCSFALVGLTIGLFPTRKLFVMWAHEINRGEQQESYPYP
FT                   RSHLAFCGVSVIVAVLAAFLLVQ"
     MFTSLATEWP WLLAVIALVI HCSAMAKWVP IQRFWTVYPF IWVLCGVGAV AIGSSQGFAL        60
     TDMLVLCSFA LVGLTIGLFP TRKLFVMWAH EINRGEQQES YPYPRSHLAF CGVSVIVAVL       120
     AAFLLVQ                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page