(data stored in ACNUC7421 zone)

EMBL: CP002047.PE89

CP002047.PE89        Location/Qualifiers
FT   CDS             82081..82317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00089"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00089"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03210"
FT                   /db_xref="GOA:D7BUL9"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUL9"
FT                   /protein_id="ADI03210.1"
FT                   /translation="MKDVAEAARISMPYLSELERGRKEGSSEVLAAAAQALGLGLADLL
FT                   SLTQDELARYARSRVGRGRTSPTAQYDGLCLVA"
     MKDVAEAARI SMPYLSELER GRKEGSSEVL AAAAQALGLG LADLLSLTQD ELARYARSRV        60
     GRGRTSPTAQ YDGLCLVA                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page