(data stored in ACNUC7421 zone)

EMBL: CP002047.PE90

CP002047.PE90        Location/Qualifiers
FT   CDS             complement(82398..83000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00090"
FT                   /product="ATP-dependent Clp protease proteolytic subunit 2"
FT                   /note="COG0740 Protease subunit of ATP-dependent Clp
FT                   proteases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00090"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03211"
FT                   /db_xref="GOA:D7BUM0"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUM0"
FT                   /protein_id="ADI03211.1"
FT                   /translation="MGSYTVPYVIERTAQGERSYDVFSRLLNERIIFLGTEIDDGVANV
FT                   VIAQLLHLESANPEREISIYLNSPGGSFTSLMAIYDTMTFVQAPISTFCVGQAASTAAV
FT                   LLAGGDPGRRFVLQHARVLLGQPASGGRQGTVSDLSLAAKEMVRIRSQVEEVLSRHTHH
FT                   DVATLRADMDRDKVLTAEEAVAYGLADEVLSRRLAFV"
     MGSYTVPYVI ERTAQGERSY DVFSRLLNER IIFLGTEIDD GVANVVIAQL LHLESANPER        60
     EISIYLNSPG GSFTSLMAIY DTMTFVQAPI STFCVGQAAS TAAVLLAGGD PGRRFVLQHA       120
     RVLLGQPASG GRQGTVSDLS LAAKEMVRIR SQVEEVLSRH THHDVATLRA DMDRDKVLTA       180
     EEAVAYGLAD EVLSRRLAFV                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page