(data stored in ACNUC7421 zone)

EMBL: CP002047.PE91

CP002047.PE91        Location/Qualifiers
FT   CDS             complement(83002..83640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00091"
FT                   /product="ATP-dependent Clp protease proteolytic subunit"
FT                   /note="COG0740 Protease subunit of ATP-dependent Clp
FT                   proteases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00091"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03212"
FT                   /db_xref="GOA:D7BUM1"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUM1"
FT                   /protein_id="ADI03212.1"
FT                   /translation="MTSLTTLPPRAEEGDTPPSRFDDHLAAQLLAQRIVLLGTQVDDVS
FT                   ANRVCAQLLLLSAEDPRTDISLYINSPGGSVTAGLAIYDTMRLIPNDVSTLAMGFAASM
FT                   GQFLLTVGTPGKRFALPNARIMMHQPSAGIGGTAADIEIQAENLQFTKEAIERITAEHT
FT                   GQSEETIARDGDRDRWFTAEQAREYGIVDRVVESVADIRPAASRRRMGL"
     MTSLTTLPPR AEEGDTPPSR FDDHLAAQLL AQRIVLLGTQ VDDVSANRVC AQLLLLSAED        60
     PRTDISLYIN SPGGSVTAGL AIYDTMRLIP NDVSTLAMGF AASMGQFLLT VGTPGKRFAL       120
     PNARIMMHQP SAGIGGTAAD IEIQAENLQF TKEAIERITA EHTGQSEETI ARDGDRDRWF       180
     TAEQAREYGI VDRVVESVAD IRPAASRRRM GL                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page