(data stored in ACNUC7421 zone)

EMBL: CP002047.PE92

CP002047.PE92        Location/Qualifiers
FT   CDS             complement(84060..84326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00092"
FT                   /product="hypothetical protein"
FT                   /note="COG0640 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00092"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03213"
FT                   /db_xref="GOA:D7BUM2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUM2"
FT                   /protein_id="ADI03213.1"
FT                   /translation="MCNAAVRPDAYEAAFSALAHPARRRVLLTAYFNGGSMAAGEIAAM
FT                   FAHSWQTTTRHLQVLEVAGLLSSERQGRSRIYRLQRRRQCGSR"
     MCNAAVRPDA YEAAFSALAH PARRRVLLTA YFNGGSMAAG EIAAMFAHSW QTTTRHLQVL        60
     EVAGLLSSER QGRSRIYRLQ RRRQCGSR                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page