(data stored in ACNUC7421 zone)

EMBL: CP002047.PE94

CP002047.PE94        Location/Qualifiers
FT   CDS             85202..85762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00094"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00094"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03215"
FT                   /db_xref="GOA:D7BUM4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUM4"
FT                   /protein_id="ADI03215.1"
FT                   /translation="MSAPARRTDAAQNRTRIVEAARAALAESNHVHLNEIAKRAGVGQG
FT                   TLYRNFPNREALLAEVYRRDVEELVTAASALLAEHEPVEALRQWLDRVIDYAEIKRGVL
FT                   AALEPTAWQDLVAHSHNPIESALGHLLDAGKTAGSIRTDVDAPGVLLLIAYLSRLDRGE
FT                   WESMARPLMNVILDGLRRQDTDR"
     MSAPARRTDA AQNRTRIVEA ARAALAESNH VHLNEIAKRA GVGQGTLYRN FPNREALLAE        60
     VYRRDVEELV TAASALLAEH EPVEALRQWL DRVIDYAEIK RGVLAALEPT AWQDLVAHSH       120
     NPIESALGHL LDAGKTAGSI RTDVDAPGVL LLIAYLSRLD RGEWESMARP LMNVILDGLR       180
     RQDTDR                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page