(data stored in ACNUC7421 zone)

EMBL: CP002047.PE95

CP002047.PE95        Location/Qualifiers
FT   CDS             complement(86012..86857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00095"
FT                   /product="putative binding-protein-dependent transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00095"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03216"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUM5"
FT                   /protein_id="ADI03216.1"
FT                   /translation="MGEYHSVVARTAAARADALGLPFLCSSAVLDALTEQPTDWVARLA
FT                   PAQSHGWRIYADFLLGAGHSRIAVSAEPSVYWASGARILRDYLAPRGGTVIELDMRALA
FT                   PTAVCDELVDNRATALLLLVGHPEPAVSIVKSVRRDQRLAEIMIGAPAGQPEFAEWATL
FT                   LGDDGAAISFLRYLPERLSPLGVRVETALRERLAEAPSFVAFEGYDTVAVLAEVLRSHG
FT                   ADRARIAESWSRVAVEGTRGQIQFSRTPGISVWQWAWTPVQVVDRDPAEPDRFRILHTG
FT                   "
     MGEYHSVVAR TAAARADALG LPFLCSSAVL DALTEQPTDW VARLAPAQSH GWRIYADFLL        60
     GAGHSRIAVS AEPSVYWASG ARILRDYLAP RGGTVIELDM RALAPTAVCD ELVDNRATAL       120
     LLLVGHPEPA VSIVKSVRRD QRLAEIMIGA PAGQPEFAEW ATLLGDDGAA ISFLRYLPER       180
     LSPLGVRVET ALRERLAEAP SFVAFEGYDT VAVLAEVLRS HGADRARIAE SWSRVAVEGT       240
     RGQIQFSRTP GISVWQWAWT PVQVVDRDPA EPDRFRILHT G                           281
//

If you have problems or comments...

PBIL Back to PBIL home page