(data stored in ACNUC7421 zone)

EMBL: CP002047.PE97

CP002047.PE97        Location/Qualifiers
FT   CDS             complement(87450..88403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00097"
FT                   /product="hypothetical protein"
FT                   /note="COG0376 Catalase (peroxidase I)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00097"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03218"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUM7"
FT                   /protein_id="ADI03218.1"
FT                   /translation="MRHALTTGVCGTLVAGALVAAGGILAVPANAAGSGVVYVSPTGRS
FT                   GNPGTQSKPVKTLADVRKVLAARQNPPTVTVLFKGGTYKLPQYRWGNWSAQSVTFKPQP
FT                   RTGTPVFDGAKRQKYWLVVDPTRTKLTFTGLRLSRYTTGGIMLRGTGTADSRRVIGATI
FT                   KGMKFTDMGGAESGYAAVHLNYARNTTITGNTFRNLVNGDCPGCMHAVYFANQSNNNTV
FT                   SGGTFSKISGDAIRAADYSNGNKVRGGSYSRTGTKAVFSAWRLARNTRCSHGNVFYTTA
FT                   RTSKSYRGATIPTVLDGADDSTKPPCTPRAVVRKNP"
     MRHALTTGVC GTLVAGALVA AGGILAVPAN AAGSGVVYVS PTGRSGNPGT QSKPVKTLAD        60
     VRKVLAARQN PPTVTVLFKG GTYKLPQYRW GNWSAQSVTF KPQPRTGTPV FDGAKRQKYW       120
     LVVDPTRTKL TFTGLRLSRY TTGGIMLRGT GTADSRRVIG ATIKGMKFTD MGGAESGYAA       180
     VHLNYARNTT ITGNTFRNLV NGDCPGCMHA VYFANQSNNN TVSGGTFSKI SGDAIRAADY       240
     SNGNKVRGGS YSRTGTKAVF SAWRLARNTR CSHGNVFYTT ARTSKSYRGA TIPTVLDGAD       300
     DSTKPPCTPR AVVRKNP                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page