(data stored in ACNUC7421 zone)

EMBL: CP002047.PE99

CP002047.PE99        Location/Qualifiers
FT   CDS             complement(90075..90650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00099"
FT                   /product="hypothetical protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00099"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03220"
FT                   /db_xref="GOA:D7BUM9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUM9"
FT                   /protein_id="ADI03220.1"
FT                   /translation="MRSDTERNRRHLIEAAARLFANSPTPVSLAEIAKEAEVSTATAYR
FT                   HFSSVEEILHAFRRQVGSDLRDFSARQTTRGMAKLEAVSRYWVSLVLEHGGAMAQMRSH
FT                   RGYLERLREGTGYLTPQAEALAEPLRQTAEELDLGELGDEALYLWNALFDPRDILDLIK
FT                   SGRTEDEAATRLVAALRGSLIGWSAAGP"
     MRSDTERNRR HLIEAAARLF ANSPTPVSLA EIAKEAEVST ATAYRHFSSV EEILHAFRRQ        60
     VGSDLRDFSA RQTTRGMAKL EAVSRYWVSL VLEHGGAMAQ MRSHRGYLER LREGTGYLTP       120
     QAEALAEPLR QTAEELDLGE LGDEALYLWN ALFDPRDILD LIKSGRTEDE AATRLVAALR       180
     GSLIGWSAAG P                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page