(data stored in ACNUC7421 zone)

EMBL: CP002047.SIG1

CP002047.SIG1        Location/Qualifiers
FT   CDS             complement(295419..296336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sig1"
FT                   /locus_tag="SBI_00270"
FT                   /product="ECF subfamily RNA polymerase sigma factor"
FT                   /note="COG1595 DNA-directed RNA polymerase specialized
FT                   sigma subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00270"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03391"
FT                   /db_xref="GOA:D7BWN5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWN5"
FT                   /protein_id="ADI03391.1"
FT                   /translation="MNRSDEPTPDSLEAAAEDFLQLRPRLFGIAYRILGSVDEAEDVVQ
FT                   DAWLRWQGTDRSVVENPGAFLATATTRLAINVAQSARVRRESHVGSWLPEPIDTSMDPH
FT                   VGAERGEALELAVMFLLEKLNPVERAAYVLREAFEYPYDQIANILQLSQANTRQIVSRS
FT                   RKRLSAERREPVDTAELRRLLEAFLAAAATGDIDALEELLSADVVAYADGNGMRGVARV
FT                   AVMGALRVARISTFAKRFIPWDEYRIVEVNGLPALLTAKEGVTTALVTITVGRDGIDGF
FT                   YWILTPEKLRAYERSSHRAVPRRP"
     MNRSDEPTPD SLEAAAEDFL QLRPRLFGIA YRILGSVDEA EDVVQDAWLR WQGTDRSVVE        60
     NPGAFLATAT TRLAINVAQS ARVRRESHVG SWLPEPIDTS MDPHVGAERG EALELAVMFL       120
     LEKLNPVERA AYVLREAFEY PYDQIANILQ LSQANTRQIV SRSRKRLSAE RREPVDTAEL       180
     RRLLEAFLAA AATGDIDALE ELLSADVVAY ADGNGMRGVA RVAVMGALRV ARISTFAKRF       240
     IPWDEYRIVE VNGLPALLTA KEGVTTALVT ITVGRDGIDG FYWILTPEKL RAYERSSHRA       300
     VPRRP                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page