(data stored in ACNUC7421 zone)

EMBL: CP002047.SIG2

CP002047.SIG2        Location/Qualifiers
FT   CDS             399584..400495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sig2"
FT                   /locus_tag="SBI_00337"
FT                   /product="RNA polymerase sigma factor"
FT                   /note="COG1595 DNA-directed RNA polymerase specialized
FT                   sigma subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00337"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03458"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYD0"
FT                   /protein_id="ADI03458.1"
FT                   /translation="MDHAGDAVPIAELLDERRYLLDVAYWMLGSGGAAESVIDETYRRW
FT                   YGLSDSARARIAVPRSWLAKTAGGICLGRLALPDRGEDTDQGEGGGPYAGDADGARASA
FT                   ELEQEISGVLLNALDSLSPAERAAFVLNEVFGMTPDTVADIVGRTGPECVELADRARRR
FT                   LRARRSRPTTPEQHDTVARTVRHACVTENAGLLASLLWPDATAFFDGGGKVRALARPVH
FT                   GSEHVAHSLMTLLVRRPRTTLTAQSVNGRTGLVARYGDQVAAVISLDIADHRVAQVWVV
FT                   LNPDKLRSWNQPPSAHQRPSQA"
     MDHAGDAVPI AELLDERRYL LDVAYWMLGS GGAAESVIDE TYRRWYGLSD SARARIAVPR        60
     SWLAKTAGGI CLGRLALPDR GEDTDQGEGG GPYAGDADGA RASAELEQEI SGVLLNALDS       120
     LSPAERAAFV LNEVFGMTPD TVADIVGRTG PECVELADRA RRRLRARRSR PTTPEQHDTV       180
     ARTVRHACVT ENAGLLASLL WPDATAFFDG GGKVRALARP VHGSEHVAHS LMTLLVRRPR       240
     TTLTAQSVNG RTGLVARYGD QVAAVISLDI ADHRVAQVWV VLNPDKLRSW NQPPSAHQRP       300
     SQA                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page