(data stored in ACNUC7421 zone)

EMBL: CP002047.SIG3

CP002047.SIG3        Location/Qualifiers
FT   CDS             complement(400537..401454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sig3"
FT                   /locus_tag="SBI_00338"
FT                   /product="RNA polymerase sigma factor"
FT                   /note="COG1595 DNA-directed RNA polymerase specialized
FT                   sigma subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00338"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03459"
FT                   /db_xref="GOA:D7BYD1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014303"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYD1"
FT                   /protein_id="ADI03459.1"
FT                   /translation="MTFTDHSPLGTTTSALDEAVSVFVQLQPRLFGIAYRVLGSAVEAE
FT                   DVVQEVWLRWQKTDRSAVVSPAAFLSSATTRLAINVAQSARVRRETYIGPWLPEPIDTS
FT                   SDPEVGAQRAEALELALLLVLEKLSPAERAAYVLREAFDYSYPEIADMLQLSVVNVRKI
FT                   VSRARKHLGAEQRESVDAEEHRRLLEAFVGAAQRGDIGSLEALLTPDAVSLSDGNGMRG
FT                   AARIPVLGRARVANLATAYPRFWRGLDLRSVHANGRSGVMIYREGEPKTFLTVAASREG
FT                   IYKVMWLFNPSKIAAFLDSRSRSM"
     MTFTDHSPLG TTTSALDEAV SVFVQLQPRL FGIAYRVLGS AVEAEDVVQE VWLRWQKTDR        60
     SAVVSPAAFL SSATTRLAIN VAQSARVRRE TYIGPWLPEP IDTSSDPEVG AQRAEALELA       120
     LLLVLEKLSP AERAAYVLRE AFDYSYPEIA DMLQLSVVNV RKIVSRARKH LGAEQRESVD       180
     AEEHRRLLEA FVGAAQRGDI GSLEALLTPD AVSLSDGNGM RGAARIPVLG RARVANLATA       240
     YPRFWRGLDL RSVHANGRSG VMIYREGEPK TFLTVAASRE GIYKVMWLFN PSKIAAFLDS       300
     RSRSM                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page