(data stored in ACNUC7421 zone)

EMBL: CP002047.SIG4

CP002047.SIG4        Location/Qualifiers
FT   CDS             408355..409278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sig4"
FT                   /locus_tag="SBI_00347"
FT                   /product="ECF subfamily RNA polymerase sigma factor"
FT                   /note="COG1595 DNA-directed RNA polymerase specialized
FT                   sigma subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00347"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03468"
FT                   /db_xref="GOA:D7BYE0"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014303"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYE0"
FT                   /protein_id="ADI03468.1"
FT                   /translation="MSKVEEFEELRPLLFSIAYRILGSVSEAEDAVQETWLRFDGSTTR
FT                   PTSTKAFLSTTVTRISIDVLRSARVRREEYVGPWFPEPLLSDPYEDPARAAELADSVSM
FT                   AALLLLERLSPLERSVFVLREVFAFGFDEIAAAVGRSEAACRQLLVRARRHMEAGRPRF
FT                   EADRQERQELATRFFDALKDGDVGGLRNLLAADAQLVGDGGGKAPQLAKAVIGAENVAR
FT                   VLGTVFPLMIRIDVTFEPHEVNGQSGAIFRDRDGKVLHTLALDVLDGRIQTIRTVINPD
FT                   KLGHLGPVADAWAIDREVKQARRQSN"
     MSKVEEFEEL RPLLFSIAYR ILGSVSEAED AVQETWLRFD GSTTRPTSTK AFLSTTVTRI        60
     SIDVLRSARV RREEYVGPWF PEPLLSDPYE DPARAAELAD SVSMAALLLL ERLSPLERSV       120
     FVLREVFAFG FDEIAAAVGR SEAACRQLLV RARRHMEAGR PRFEADRQER QELATRFFDA       180
     LKDGDVGGLR NLLAADAQLV GDGGGKAPQL AKAVIGAENV ARVLGTVFPL MIRIDVTFEP       240
     HEVNGQSGAI FRDRDGKVLH TLALDVLDGR IQTIRTVINP DKLGHLGPVA DAWAIDREVK       300
     QARRQSN                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page